H-2 class II histocompatibility antigen gamma chain Recombinant Protein | Cd74 recombinant protein

Recombinant Mouse H-2 class II histocompatibility antigen gamma chain

Cat. Num. AAA952228

• Gene Names: Cd74; Ii; CLIP; DHLAG; HLADG; Ia-GAMMA
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: H-2 class II histocompatibility antigen gamma chain; Recombinant Mouse H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74; Cd74 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 56-279aa; Extracellular Domain
• Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
• Sequence Length: 215

• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for Cd74 recombinant protein

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

References

Primary structure of the gene for the murine Ia antigen-associated invariant chains (Ii) . An alternatively spliced exon encodes a cysteine-rich domain highly homologous to a repetitive sequence of thyroglobulin.Koch N., Lauer W., Habicht J., Dobberstein B.EMBO J. 6:1677-1683(1987) Complete sequence of the murine invariant chain (Ii) gene.Zhu L., Jones P.P.Nucleic Acids Res. 17:447-448(1989) Nucleotide sequences of the murine Ia-associated invariant chain (Ii) and I-E (H-2S, Beta) chain expressible cDNA clones.Stone J., Perry R., Todd J.A., McDevitt H.O. The IFN-gamma response of the murine invariant chain gene is mediated by a complex enhancer that includes several MHC class II consensus elements.Eades A.-M., Litfin M., Rahmsdorf H.J.J. Immunol. 144:4399-4409(1990) Structure of the murine Ia-associated invariant (Ii) chain as deduced from a cDNA clone.Singer P.A., Lauer W., Dembic Z., Mayer W.E., Lipp J., Koch N., Hammerling G., Klein J., Dobberstein B.EMBO J. 3:873-877(1984) Identification of the glycosaminoglycan-attachment site of mouse invariant-chain proteoglycan core protein by site-directed mutagenesis.Miller J., Hatch J.A., Simonis S., Cullen S.E.Proc. Natl. Acad. Sci. U.S.A. 85:1359-1363(1988) The phagosomal proteome in interferon-gamma-activated macrophages.Trost M., English L., Lemieux S., Courcelles M., Desjardins M., Thibault P.Immunity 30:143-154(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 110624770
• NCBI GeneID: 16149
• NCBI Accession #: NP_001036070.1
• NCBI GenBank Nucleotide #: NM_001042605.1
• UniProt Accession #: P04441; O19452
• Molecular Weight: 29.4 kDa
• NCBI Official Full Name: H-2 class II histocompatibility antigen gamma chain isoform 1
• NCBI Official Synonym Full Names: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)
• NCBI Official Symbol: Cd74
• NCBI Official Synonym Symbols: Ii; CLIP; DHLAG; HLADG; Ia-GAMMA
• NCBI Protein Information: H-2 class II histocompatibility antigen gamma chain
• UniProt Protein Name: H-2 class II histocompatibility antigen gamma chain
• Protein Family: H-2 class II histocompatibility antigen
• UniProt Gene Name: Cd74
• UniProt Synonym Gene Names: Ii; Ii
• UniProt Entry Name: HG2A_MOUSE

Uniprot Description

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Receptor, cytokine

Cellular Component: cell surface; endoplasmic reticulum; external side of plasma membrane; Golgi apparatus; integral to membrane; integral to plasma membrane; late endosome; lysosome; membrane; MHC class II protein complex; multivesicular body; plasma membrane; vacuole

Molecular Function: beta-amyloid binding; cytokine binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; MHC class II protein binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding; protein binding

Biological Process: activation of MAPK activity; adaptive immune response; antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; cell proliferation; chaperone cofactor-dependent protein folding; defense response; immune response; immune system process; immunoglobulin mediated immune response; intracellular protein transport; negative regulation of apoptosis; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of peptide secretion; negative regulation of T cell differentiation; negative thymic T cell selection; positive regulation of adaptive immune response; positive regulation of B cell proliferation; positive regulation of cytokine and chemokine mediated signaling pathway; positive regulation of dendritic cell antigen processing and presentation; positive regulation of fibroblast proliferation; positive regulation of innate immune response; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; positive regulation of T-helper 2 type immune response; positive thymic T cell selection; prostaglandin biosynthetic process; protein complex assembly; signal transduction