H-2 class II histocompatibility antigen gamma chain Recombinant Protein | Cd74 recombinant protein

Recombinant Rat H-2 class II histocompatibility antigen gamma chain

Cat. Num. AAA948464

• Gene Names: Cd74; INVG34
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: H-2 class II histocompatibility antigen gamma chain; Recombinant Rat H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; IiMHC class II-associated invariant chain; CD74; Cd74 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 57-280aa; Extracellular Domain
• Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKSAKPVSPMRMATPLLMRPLSMDNMLQAPVKNVTKYGNMTQDHVMHLLTKSGPVNYPQLKGSFPENLKHLKNSMNGLDWKVFESWMKQWLLFEMSKNSLEEKQPTQTPPKVLTKCQEEVSHIPDVHPGAFRPKCDENGNYMPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDPSSGLGVTKQDMGQMFL
• Sequence Length: 216

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Cd74 recombinant protein

Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place.

References

Sequence of a rat MHC class II-associated invariant chain cDNA clone containing a 64 amino acid thyroglobulin-like domain.McKnight A.J., Mason D.W., Barclay A.N.Nucleic Acids Res. 17:3983-3984(1989) Nucleotide sequence of rat invariant gamma chain cDNA clone pLR gamma 34.3.Henkes W., Syha J., Reske K.Nucleic Acids Res. 16:11822-11822(1988)

NCBI and Uniprot Product Information

• NCBI GI #: 6978637
• NCBI GeneID: 25599
• NCBI Accession #: NP_037201.1
• NCBI GenBank Nucleotide #: NM_013069.2
• UniProt Accession #: P10247
• Molecular Weight: 29.5 kDa
• NCBI Official Full Name: H-2 class II histocompatibility antigen gamma chain
• NCBI Official Synonym Full Names: CD74 molecule
• NCBI Official Symbol: Cd74
• NCBI Official Synonym Symbols: INVG34
• NCBI Protein Information: H-2 class II histocompatibility antigen gamma chain
• UniProt Protein Name: H-2 class II histocompatibility antigen gamma chain
• Protein Family: H-2 class II histocompatibility antigen
• UniProt Gene Name: Cd74
• UniProt Synonym Gene Names: Ii
• UniProt Entry Name: HG2A_RAT

Uniprot Description

CD74: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF. A chromosomal aberration involving CD74 is found in a non-small cell lung tumor. Results in the formation of a CD74- ROS1 chimeric protein. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Membrane protein, integral; Receptor, cytokine

Cellular Component: cell surface; endoplasmic reticulum; external side of plasma membrane; Golgi apparatus; integral to membrane; late endosome; lysosome; membrane; MHC class II protein complex; multivesicular body; plasma membrane; vacuole

Molecular Function: beta-amyloid binding; cytokine binding; hematopoietin/interferon-class (D200-domain) cytokine receptor activity; MHC class II protein binding; MHC class II protein binding, via antigen binding groove; nitric-oxide synthase binding

Biological Process: activation of MAPK activity; antigen processing and presentation; antigen processing and presentation of exogenous peptide antigen via MHC class II; cell proliferation; chaperone cofactor-dependent protein folding; defense response; immunoglobulin mediated immune response; intracellular protein transport; negative regulation of apoptosis; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of peptide secretion; negative regulation of T cell differentiation; negative thymic T cell selection; positive regulation of B cell proliferation; positive regulation of cytokine and chemokine mediated signaling pathway; positive regulation of dendritic cell antigen processing and presentation; positive regulation of fibroblast proliferation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of T cell differentiation; positive regulation of T-helper 2 type immune response; positive thymic T cell selection; prostaglandin biosynthetic process; protein complex assembly; signal transduction