CD5 recombinant protein

Recombinant Human CD5 Protein

Cat. Num. AAA9141763

• Gene Names: CD5; T1; LEU1
• Purity: >95% by SDS-PAGE.
• Synonyms: CD5; Recombinant Human CD5 Protein; LEU1; T1; CD5 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPN
• Sequence Length: 495

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human CD5 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 50 kDa.)

Related Product Information for CD5 recombinant protein

Description: Recombinant Human CD5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg25-Asn371) of human CD5 (Accession #NP_055022.2) fused with a 6xHis tag at the C-terminus.

Background: CD5, also known as Leu-1, Ly-1, and T1, is a 67 kDa transmembrane glycoprotein in the scavenger receptor superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation.

Product Categories/Family for CD5 recombinant protein

CD Antigen

NCBI and Uniprot Product Information

• NCBI GI #: 166197668
• NCBI GeneID: 921
• NCBI Accession #: NP_055022.2
• NCBI GenBank Nucleotide #: NP_055022.2
• UniProt Accession #: P06127
• NCBI Official Full Name: T-cell surface glycoprotein CD5 isoform 1
• NCBI Official Synonym Full Names: CD5 molecule
• NCBI Official Symbol: CD5
• NCBI Official Synonym Symbols: T1; LEU1
• NCBI Protein Information: T-cell surface glycoprotein CD5
• UniProt Protein Name: T-cell surface glycoprotein CD5
• Protein Family: CD5 antigen
• UniProt Gene Name: CD5
• UniProt Synonym Gene Names: LEU1
• UniProt Entry Name: CD5_HUMAN

NCBI Description

This gene encodes a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2016]

Uniprot Description

CD5: a surface glycoprotein expressed on T cells and B-1 B cells. Rapidly recruited to the immunological synapse, lowering the response of the T cell antigen receptor. CD5 interacts with CD72/LYB-2. Promotes B-cell survival through stimulation of autocrine IL-10 production. Contains 3 SRCR domains.

Protein type: Cell surface; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: protein binding; transmembrane receptor activity; receptor activity; scavenger receptor activity

Biological Process: receptor-mediated endocytosis; cell proliferation; T cell costimulation; cell recognition