Western Blot (WB)
(RALB rabbit polyclonal antibody. Western Blot analysis of RALB expression in human kidney.)
Rabbit anti-Human, Mouse RALB Polyclonal Antibody | anti-RALB antibody
RALB (Ras-related Protein Ral-B) (PE)
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RALB; Polyclonal Antibody; RALB (Ras-related Protein Ral-B) (PE); anti-RALB antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human RALB. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-RALB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human RALB, aa1-206 (NP_002872.1).
Immunogen Sequence
MAANKSKGQSSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLLVFSITEHESFTATAEFREQILRVKAEEDKIPLLVVGNKSDLEERRQVPVEEARSKAEEWGVQYVETSAKTRANVDKVFFDLMREIRTKKMSENKDKNGKKSSKNKKSFKERCCLL
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(RALB rabbit polyclonal antibody. Western Blot analysis of RALB expression in human kidney.)
Western Blot (WB)
(RALB rabbit polyclonal antibody. Western Blot analysis of RALB expression in human kidney.)
Western Blot (WB)
(RALB rabbit polyclonal antibody. Western Blot analysis of RALB expression in mouse lung.)
Western Blot (WB)
(RALB rabbit polyclonal antibody. Western Blot analysis of RALB expression in mouse lung.)
Western Blot (WB)
(Western Blot analysis of RALB expression in transfected 293T cell line by RALB polyclonal antibody. Lane 1: RALB transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of RALB expression in transfected 293T cell line by RALB polyclonal antibody. Lane 1: RALB transfected lysate (23.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RALB antibody
The human RAL proteins share more than 50% similarity and some properties with the ras proteins. One member of this family, RALA, maps to 7p. A second member of the family, RALB, encoding a GTP-binding protein is located on 2cen-q13.
Product Categories/Family for anti-RALB antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
206
NCBI Official Full Name
ras-related protein Ral-B
NCBI Official Synonym Full Names
v-ral simian leukemia viral oncogene homolog B
NCBI Official Symbol
RALB
NCBI Protein Information
ras-related protein Ral-B; RAS-like protein B; ras related GTP binding protein; ras related GTP binding protein B; v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein)
UniProt Protein Name
Ras-related protein Ral-B
Protein Family
UniProt Gene Name
RALB
UniProt Entry Name
RALB_HUMAN
Similar Products
Product Notes
The RALB ralb (Catalog #AAA6391945) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RALB (Ras-related Protein Ral-B) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's RALB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RALB ralb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RALB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
