Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Scavenger receptor cysteine-rich type 1 protein M130 Recombinant Protein | Cd163 recombinant protein

Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130 (Cd163), partial

Gene Names
Cd163; CD163v2; CD163v3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Scavenger receptor cysteine-rich type 1 protein M130; Recombinant Mouse Scavenger receptor cysteine-rich type 1 protein M130 (Cd163); partial; CD163; Cd163 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
86-365. Partial.
Sequence
VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS
Sequence Length
365
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Cd163 recombinant protein
Involved in clearance and endocytosis of hoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin/haptoglobin and subsequent breakdown of he. Binds hoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. After shedding, the soluble form (sCD163) may play an anti-inflammatory role.
References
Molecular cloning and characterization of the mouse CD163 homologue, a highly glucocorticoid-inducible member of the scavenger receptor cysteine-rich family.Schaer D.J., Boretti F.S., Hongegger A., Poehler D., Linnscheid P., Staege H., Mueller C., Schoedon G., Schaffner A.Immunogenetics 53:170-177(2001) Scavenger receptor cd163 is a cell permissive factor for infection with porcine reproductive and respiratory syndrome viruses.Welch S.-K.W., Calvert J.G., Slade D.E., Shields S.L. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32.2 kDa
NCBI Official Full Name
scavenger receptor cysteine-rich type 1 protein M130 isoform 2
NCBI Official Synonym Full Names
CD163 antigen
NCBI Official Symbol
Cd163
NCBI Official Synonym Symbols
CD163v2; CD163v3
NCBI Protein Information
scavenger receptor cysteine-rich type 1 protein M130
UniProt Protein Name
Scavenger receptor cysteine-rich type 1 protein M130
UniProt Gene Name
Cd163
UniProt Synonym Gene Names
M130; sCD163
UniProt Entry Name
C163A_MOUSE

Uniprot Description

CD163: Acute phase-regulated receptor involved in clearance and endocytosis of hemoglobin/haptoglobin complexes by macrophages and may thereby protect tissues from free hemoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hemoglobin/haptoglobin and subsequent breakdown of heme. Binds hemoglobin/haptoglobin complexes in a calcium-dependent and pH-dependent manner. Exhibits a higher affinity for complexes of hemoglobin and multimeric haptoglobin of HP*1F phenotype than for complexes of hemoglobin and dimeric haptoglobin of HP*1S phenotype. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1. Isoform 3 exhibits the higher capacity for ligand endocytosis and the more pronounced surface expression when expressed in cells. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Cellular Component: extracellular region; integral to membrane; membrane; plasma membrane

Molecular Function: scavenger receptor activity

Biological Process: acute-phase response; inflammatory response

Research Articles on Cd163

Similar Products

Product Notes

The Cd163 cd163 (Catalog #AAA1352717) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 86-365. Partial. The amino acid sequence is listed below: VVCQQLGCPT SIKALGWANS SAGSGYIWMD KVSCTGNESA LWDCKHDGWG KHNCTHEKDA GVTCSDGSNL EMRLVNSAGH RCLGRVEIKF QGKWGTVCDD NFSKDHASVI CKQLGCGSAI SFSGSAKLGA GSGPIWLDDL ACNGNESALW DCKHRGWGKH NCDHAEDVGV ICLEGADLSL RLVDGVSRCS GRLEVRFQGE WGTVCDDNWD LRDASVVCKQ LGCPTAISAI GRVNASEGSG QIWLDNISCE GHEATLWECK HQEWGKHYCH HREDAGVTCS . It is sometimes possible for the material contained within the vial of "Scavenger receptor cysteine-rich type 1 protein M130, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.