Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse FKBP4 Monoclonal Antibody | anti-FKBP4 antibody

FKBP4 (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) (Biot

Gene Names
FKBP4; HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FKBP4; Monoclonal Antibody; FKBP4 (FK506-binding Protein 4; Peptidyl-prolyl cis-trans Isomerase FKBP4; PPIase FKBP4; Rotamase; HSP-binding Immunophilin; HBI; FKBP52 Protein; 52kD FK506-binding Protein; 52kD FKBP; FKBP-52; 59kD Immunophilin; FKBP59; p59 Protein; FKBP-4; FKBP52) (Biot; anti-FKBP4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C11
Specificity
Recognizes human FKBP4. Species Crossreactivity: mouse and rat
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2196
Applicable Applications for anti-FKBP4 antibody
ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa301-410 from human FKBP4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(Western Blot analysis of FKBP4 expression in HeLa cells using 126835.)

Western Blot (WB) (Western Blot analysis of FKBP4 expression in HeLa cells using 126835.)

Western Blot (WB)

(Western Blot analysis of FKBP4 expression in PC-12 using 126835.)

Western Blot (WB) (Western Blot analysis of FKBP4 expression in PC-12 using 126835.)

Western Blot (WB)

(Western Blot analysis of FKBP4 expression in Raw 264.7 using 126835.)

Western Blot (WB) (Western Blot analysis of FKBP4 expression in Raw 264.7 using 126835.)

Immunohistochemistry (IHC)

(Immunoperoxidase of paraffin-embedded human uterine cervix using 126835 (0.5ug/ml))

Immunohistochemistry (IHC) (Immunoperoxidase of paraffin-embedded human uterine cervix using 126835 (0.5ug/ml))

Testing Data

()

Testing Data ()
Product Categories/Family for anti-FKBP4 antibody
References
1. Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women. Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J.Clin Cancer Res. 2009 Jul 15;15(14):4733-41. Epub 2009 Jul 7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens FK506 binding protein 4, 59kDa, mRNA
NCBI Official Synonym Full Names
FKBP prolyl isomerase 4
NCBI Official Symbol
FKBP4
NCBI Official Synonym Symbols
HBI; p52; Hsp56; FKBP51; FKBP52; FKBP59; PPIase
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP4

NCBI Description

The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It has high structural and functional similarity to FK506-binding protein 1A (FKBP1A), but unlike FKBP1A, this protein does not have immunosuppressant activity when complexed with FK506. It interacts with interferon regulatory factor-4 and plays an important role in immunoregulatory gene expression in B and T lymphocytes. This encoded protein is known to associate with phytanoyl-CoA alpha-hydroxylase. It can also associate with two heat shock proteins (hsp90 and hsp70) and thus may play a role in the intracellular trafficking of hetero-oligomeric forms of the steroid hormone receptors. This protein correlates strongly with adeno-associated virus type 2 vectors (AAV) resulting in a significant increase in AAV-mediated transgene expression in human cell lines. Thus this encoded protein is thought to have important implications for the optimal use of AAV vectors in human gene therapy. The human genome contains several non-transcribed pseudogenes similar to this gene. [provided by RefSeq, Sep 2008]

Research Articles on FKBP4

Similar Products

Product Notes

The FKBP4 (Catalog #AAA6141916) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FKBP4 (FK506-binding Protein 4, Peptidyl-prolyl cis-trans Isomerase FKBP4, PPIase FKBP4, Rotamase, HSP-binding Immunophilin, HBI, FKBP52 Protein, 52kD FK506-binding Protein, 52kD FKBP, FKBP-52, 59kD Immunophilin, FKBP59, p59 Protein, FKBP-4, FKBP52) (Biot reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.