CD14 recombinant protein

Recombinant Human CD14, HEK

Cat. Num. AAA146148

• Purity: Greater than 95% as determined by SDS-PAGE.
• Synonyms: CD14; Recombinant Human CD14; HEK; CD14 Human HEK; CD14 Human Recombinant HEK; Monocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14 HEK; CD14 recombinant protein

• Host: HEK293 Cells
• Purity/Purification: Greater than 95% as determined by SDS-PAGE.
• Form/Format: CD14 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, PH 7.4.; Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH
• Sequence Length: 375

• Solubility: It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.

Related Product Information for CD14 recombinant protein

Description: CD14 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 341 amino acids (20-352). CD14 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Introduction: CD14 (also known lipopolysaccharide (LPS) receptor) is expressed strongly on monocytes and macrophage and weakly on the surface of neutrophils. CD14 is anchored to cells by linkage to glycosylphosphatidylinositol (GPI) and functions as a high affinity receptor for complexes of LPS and LPS binding protein (LBP). Soluble CD14, also binding to LPS, acts at physiological concentration as an LPS agonist and has, at higher concentrations, an LPS antagonizing effect in cell activation. CD14 has been shown to bind apoptotic cells.

Product Categories/Family for CD14 recombinant protein

Recombinant & Natural Proteins; CD Antigens

NCBI and Uniprot Product Information

• NCBI GI #: 4557417
• NCBI GeneID: 929
• NCBI Accession #: NP_000582.1
• NCBI GenBank Nucleotide #: NM_000591.3
• UniProt Accession #: P08571; Q53XT5; Q96FR6; Q96L99; Q9UNS3
• Molecular Weight: 40,076 Da
• NCBI Official Full Name: monocyte differentiation antigen CD14
• NCBI Official Synonym Full Names: CD14 molecule
• NCBI Official Symbol: CD14
• NCBI Protein Information: monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein
• UniProt Protein Name: Monocyte differentiation antigen CD14
• Protein Family: Monocyte differentiation antigen
• UniProt Gene Name: CD14
• UniProt Entry Name: CD14_HUMAN

NCBI Description

The protein encoded by this gene is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Mar 2010]

Uniprot Description

CD14: Cooperates with MD-2 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). Acts via MyD88, TIRAP and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Up-regulates cell surface molecules, including adhesion molecules.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: extracellular space; cell surface; plasma membrane; extracellular region; endosome membrane; lipid raft

Molecular Function: peptidoglycan receptor activity; protein binding; opsonin receptor activity; lipopolysaccharide binding

Biological Process: I-kappaB kinase/NF-kappaB cascade; apoptosis; MyD88-independent toll-like receptor signaling pathway; positive regulation of endocytosis; toll-like receptor 3 signaling pathway; positive regulation of tumor necrosis factor production; phagocytosis; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; response to magnesium ion; response to ethanol; cell surface receptor linked signal transduction; response to heat; toll-like receptor signaling pathway; innate immune response; response to electrical stimulus; inflammatory response; toll-like receptor 4 signaling pathway; positive regulation of cytokine secretion