Testing Data
()
CD14 recombinant protein
CD14 Protein
Purity
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Synonyms
CD14; CD14 Protein; CD14 recombinant protein
Host
E Coli
Purity/Purification
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
Form/Format
PBS, 4M Urea, PH7.4
Concentration
>=0.5mg/ml (varies by lot)
Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
Tag
His-tag in C-terminal
Expression Vector
pet-22b(+)
BP
990
Restriction Site
NdeI-XhoI
Preparation and Storage
Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.
Testing Data
()
Testing Data
()
Related Product Information for CD14 recombinant protein
Background: CD14 is a leucine-rich repeat-containing pattern recognition receptor with expression largely restricted to the monocyte/macrophage cell lineage. Research studies have shown that CD14 is a bacterial lipopolysaccharide (LPS) binding glycoprotein, expressed as either a GPI-linked membrane protein or a soluble plasma protein. LPS induces an upregulation of GPI-linked CD14 expression, which facilitates TLR4 signaling and macrophage activation in response to bacterial infection. The 61D3 antibody is widely used to identify cells of the monocyte/macrophage lineage.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53kDa
NCBI Official Full Name
monocyte differentiation antigen CD14
NCBI Official Synonym Full Names
CD14 molecule
NCBI Official Symbol
CD14
NCBI Protein Information
monocyte differentiation antigen CD14; myeloid cell-specific leucine-rich glycoprotein
UniProt Protein Name
Monocyte differentiation antigen CD14
Protein Family
UniProt Gene Name
CD14
UniProt Entry Name
CD14_HUMAN
Similar Products
Product Notes
The CD14 cd14 (Catalog #AAA3003453) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TTPEPCELDD EDFRCVCNFS EPQPDWSEAF QCVSAVEVEI HAGGLNLEPF LKRVDADADP RQYADTVKAL RVRRLTVGAA QVPAQLLVGA LRVLAYSRLK ELTLEDLKIT GTMPPLPLEA TGLALSSLRL RNVSWATGRS WLAELQQWLK PGLKVLSIAQ AHSPAFSCEQ VRAFPALTSL DLSDNPGLGE RGLMAALCPH KFPAIQNLAL RNTGMETPTG VCAALAAAGV QPHSLDLSHN SLRATVNPSA PRCMWSSALN SLNLSFAGLE QVPKGLPAKL RVLDLSCNRL NRAPQPDELP EVDNLTLDGN PFLVPGTALP HEGSMN. It is sometimes possible for the material contained within the vial of "CD14, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
