Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

C-C chemokine receptor type 2 (Ccr2) Recombinant Protein | Ccr2 recombinant protein

Recombinant Mouse C-C chemokine receptor type 2 (Ccr2)

Gene Names
Ccr2; Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
C-C chemokine receptor type 2 (Ccr2); Recombinant Mouse C-C chemokine receptor type 2 (Ccr2); Ccr2 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-373. Full length
Sequence
MEDNNMLPQFIHGILSTSHSLFTRSIQELDEGATTPYDYDDGEPCHKTSVKQIGAWILPPLYSLVFIFGFVGNMLVIIILIGCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAANEWVFGNIMCKVFTGLYHIGYFGGIFFIILLTIDRYLAIVHAVFALKARTVTFGVITSVVTWVVAVFASLPGIIFTKSKQDDHHYTCGPYFTQLWKNFQTIMRNILSLILPLLVMVICYSGILHTLFRCRNEKKRHRAVRLIFAIMIVYFLFWTPYNIVLFLTTFQESLGMSNCVIDKHLDQAMQVTETLGMTHCCINPVIYAFVGEKFRRYLSIFFRKHIAKRLCKQCPVFYRETADRVSSTFTPSTGEQEVSVGL
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Ccr2 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,783 Da
NCBI Official Full Name
C-C chemokine receptor type 2
NCBI Official Synonym Full Names
chemokine (C-C motif) receptor 2
NCBI Official Symbol
Ccr2
NCBI Official Synonym Symbols
Ckr2; Ccr2a; Ccr2b; Ckr2a; Ckr2b; mJe-r; Cmkbr2; Cc-ckr-2
NCBI Protein Information
C-C chemokine receptor type 2
UniProt Protein Name
C-C chemokine receptor type 2
Protein Family
UniProt Gene Name
Ccr2
UniProt Synonym Gene Names
Cmkbr2; C-C CKR-2; CC-CKR-2; CCR-2; CCR2
UniProt Entry Name
CCR2_MOUSE

Uniprot Description

CCR2: a seven transmembrane protein closely related to CCR1. Receptor for the MCP-1, MCP-3 and MCP-4 chemokines. Expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. Transduces a signal by increasing the intracellular calcium ions level. Alternative co receptor with CD4 for HIV-1 infection. Two splice-variant isoforms have been described.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR; Membrane protein, integral

Cellular Component: external side of plasma membrane; integral to membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: C-C chemokine receptor activity; chemokine receptor activity; cytokine binding; G-protein coupled receptor activity; protein binding; signal transducer activity

Biological Process: angiogenesis; apoptotic cell clearance; blood vessel remodeling; cellular defense response; cellular homeostasis; chemotaxis; cytokine and chemokine mediated signaling pathway; G-protein coupled receptor protein signaling pathway; healing during inflammatory response; hemopoiesis; humoral immune response; immune response; inflammatory response; monocyte chemotaxis; negative regulation of angiogenesis; negative regulation of eosinophil degranulation; negative regulation of T-helper 2 type immune response; positive regulation of alpha-beta T cell proliferation; positive regulation of inflammatory response; positive regulation of interferon-gamma production; positive regulation of interleukin-2 production; positive regulation of T cell activation; positive regulation of T-helper 1 cell differentiation; positive regulation of T-helper 1 type immune response; positive regulation of tumor necrosis factor biosynthetic process; regulation of cell migration; sensory perception of pain; signal transduction

Research Articles on Ccr2

Similar Products

Product Notes

The Ccr2 ccr2 (Catalog #AAA7011006) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-373. Full length. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Ccr2 ccr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDNNMLPQF IHGILSTSHS LFTRSIQELD EGATTPYDYD DGEPCHKTSV KQIGAWILPP LYSLVFIFGF VGNMLVIIIL IGCKKLKSMT DIYLLNLAIS DLLFLLTLPF WAHYAANEWV FGNIMCKVFT GLYHIGYFGG IFFIILLTID RYLAIVHAVF ALKARTVTFG VITSVVTWVV AVFASLPGII FTKSKQDDHH YTCGPYFTQL WKNFQTIMRN ILSLILPLLV MVICYSGILH TLFRCRNEKK RHRAVRLIFA IMIVYFLFWT PYNIVLFLTT FQESLGMSNC VIDKHLDQAM QVTETLGMTH CCINPVIYAF VGEKFRRYLS IFFRKHIAKR LCKQCPVFYR ETADRVSSTF TPSTGEQEVS VGL . It is sometimes possible for the material contained within the vial of "C-C chemokine receptor type 2 (Ccr2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.