Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit IL13RA2 Polyclonal Antibody | anti-IL13RA2 antibody

IL13RA2 antibody - middle region

Gene Names
IL13RA2; CT19; IL-13R; IL13BP; CD213A2
Reactivity
Human, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL13RA2; Polyclonal Antibody; IL13RA2 antibody - middle region; anti-IL13RA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP
Sequence Length
380
Applicable Applications for anti-IL13RA2 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-IL13RA2 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-IL13RA2 antibody
This is a rabbit polyclonal antibody against IL13RA2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-IL13RA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
interleukin-13 receptor subunit alpha-2
NCBI Official Synonym Full Names
interleukin 13 receptor subunit alpha 2
NCBI Official Symbol
IL13RA2
NCBI Official Synonym Symbols
CT19; IL-13R; IL13BP; CD213A2
NCBI Protein Information
interleukin-13 receptor subunit alpha-2
UniProt Protein Name
Interleukin-13 receptor subunit alpha-2
Protein Family
UniProt Gene Name
IL13RA2
UniProt Synonym Gene Names
IL13R; IL-13 receptor subunit alpha-2; IL-13R subunit alpha-2; IL-13R-alpha-2; IL-13RA2
UniProt Entry Name
I13R2_HUMAN

NCBI Description

The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. [provided by RefSeq, Jul 2008]

Uniprot Description

IL13RA2: a type I membrane protein that binds with high affinity to interleukin-13 (IL13), but not to interleukin-4 (IL4). Lacks a cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. A member of the Cancer-Testis Antigen (CTA) superfamily. CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovarian cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding. The box 1 motif is required for JAK interaction and/or activation. Often overexpressed in brain tumors. A potential vaccine targets for immunotherapy of glioma. Note: This description may include information from RefSeq and UniProtKB

Protein type: Membrane protein, integral; Receptor, cytokine; Cancer Testis Antigen (CTA)

Chromosomal Location of Human Ortholog: Xq23

Cellular Component: extracellular space; integral to membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; signal transducer activity

Biological Process: cytokine and chemokine mediated signaling pathway; signal transduction

Research Articles on IL13RA2

Similar Products

Product Notes

The IL13RA2 il13ra2 (Catalog #AAA3211367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL13RA2 antibody - middle region reacts with Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IL13RA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL13RA2 il13ra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GQNIGCRFPY LEASDYKDFY ICVNGSSENK PIRSSYFTFQ LQNIVKPLPP. It is sometimes possible for the material contained within the vial of "IL13RA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.