Baculoviral IAP repeat-containing protein 5.1 (birc5.1) Recombinant Protein | birc5.1 recombinant protein

Recombinant Xenopus tropicalis Baculoviral IAP repeat-containing protein 5.1 (birc5.1)

Cat. Num. AAA1460913

• Gene Names: birc5.1; Su2; BIR1; api4; svv1; XBIR1; epr-1; xsurv; Survivin; Survivin1; birc5.1-a; birc5.1-b; xSurvivin1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Baculoviral IAP repeat-containing protein 5.1 (birc5.1); Recombinant Xenopus tropicalis Baculoviral IAP repeat-containing protein 5.1 (birc5.1); birc5.1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-160, Full length protein
• Sequence: MHSAKNRFVQAVQRLQDFRNMYDYEARLATFADWPFTENCKCTPENMAKAGFVHCPTENEPDVACCFFCLKELEGWEPDDDPWTEHSKRSASCGFLSLTKCVNDLTMEGFLRLEADRIKSFYRKFSTVVLQYVEEEMTATTKRLLEYFSNQHQCSIDLDR
• Sequence Length: 160

• Species: Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 113205678
• NCBI GeneID: 733532
• NCBI Accession #: NP_001037919.1
• NCBI GenBank Nucleotide #: NM_001044454.1
• UniProt Accession #: Q28H51
• Molecular Weight: 18,756 Da
• NCBI Official Full Name: baculoviral IAP repeat-containing protein 5.1
• NCBI Official Synonym Full Names: baculoviral IAP repeat-containing 5, gene 1
• NCBI Official Symbol: birc5.1
• NCBI Official Synonym Symbols: Su2; BIR1; api4; svv1; XBIR1; epr-1; xsurv; Survivin; Survivin1; birc5.1-a; birc5.1-b; xSurvivin1
• NCBI Protein Information: baculoviral IAP repeat-containing protein 5.1
• UniProt Protein Name: Baculoviral IAP repeat-containing protein 5.1
• Protein Family: Baculoviral IAP repeat-containing protein
• UniProt Gene Name: birc5.1

Uniprot Description

Component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Stimulates the mitotic kinase activity of aurkb/aurora-B in the CPC. Does not appear to exhibit anti-apoptotic activity ().