Basic leucine zipper transcriptional factor ATF-like (Batf) Recombinant Protein | Batf recombinant protein

Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)

Cat. Num. AAA1165634

• Gene Names: Batf; B-ATF; SFA-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Basic leucine zipper transcriptional factor ATF-like (Batf); Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf); Batf recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-125, Full length protein
• Sequence: MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
• Sequence Length: 125

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Batf recombinant protein

This protein is a nuclear basic leucine zipper protein that belongs to the AP-1
ATF superfamily of transcription factors. The leucine zipper of this protein mediates dimerization with members of the Jun family of proteins. This protein is thought to be a negative regulator of AP-1
ATF transcriptional events.

NCBI and Uniprot Product Information

• NCBI GI #: 7949007
• NCBI GeneID: 53314
• NCBI Accession #: NP_058047.1
• NCBI GenBank Nucleotide #: NM_016767.2
• UniProt Accession #: O35284; A2RT86
• Molecular Weight: 14,065 Da
• NCBI Official Full Name: basic leucine zipper transcriptional factor ATF-like
• NCBI Official Synonym Full Names: basic leucine zipper transcription factor, ATF-like
• NCBI Official Symbol: Batf
• NCBI Official Synonym Symbols: B-ATF; SFA-2
• NCBI Protein Information: basic leucine zipper transcriptional factor ATF-like
• UniProt Protein Name: Basic leucine zipper transcriptional factor ATF-like
• Protein Family: Basic leucine zipper transcriptional factor
• UniProt Gene Name: Batf
• UniProt Synonym Gene Names: B-ATF

Uniprot Description

AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8+ dendritic cells and class-switch recombination (CSR) in B-cells. Acts via the formation of a heterodimer with JUNB that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3'. The BATF-JUNB heterodimer also forms a complex with IRF4 (or IRF8) in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 (or IRF8) and activation of genes. Controls differentiation of T-helper cells producing interleukin-17 (Th17 cells) by binding to Th17-associated gene promoters: regulates expression of the transcription factor RORC itself and RORC target genes such as IL17 (IL17A or IL17B). Also involved in differentiation of follicular T-helper cells (TfH) by directing expression of BCL6 and MAF. In B-cells, involved in class-switch recombination (CSR) by controlling the expression of both AICDA and of germline transcripts of the intervening heavy-chain region and constant heavy-chain region (I(H)-C(H)). Following infection, can participate in CD8+ dendritic cell differentiation via interaction with IRF4 and IRF8 to mediate cooperative gene activation. Regulates effector CD8+ T-cell differentiation by regulating expression of SIRT1. Following DNA damage, part of a differentiation checkpoint that limits self-renewal of hematopoietic stem cells (HSCs): up-regulated by STAT3, leading to differentiation of HSCs, thereby restricting self-renewal of HSCs.