Potassium-transporting ATPase subunit beta (ATP4B) Recombinant Protein | ATP4B recombinant protein

Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B), partial

Cat. Num. AAA7053746

• Gene Names: ATP4B; ATP6B
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Potassium-transporting ATPase subunit beta (ATP4B); Recombinant Human Potassium-transporting ATPase subunit beta (ATP4B); partial; Gastric H(+)/K(+) ATPase subunit beta; Proton pump beta chain; ATP4B recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 58-291. Partial
• Sequence: CLYVLMQTVDPYTPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADMLQNCSGLADPNFGFEEGKPCFIIKMNRIVKFLPSNGSAPRVDCAFLDQPRELGQPLQVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCKVMAEHVTFNNPHDPYEGKVEFKLKIEK

• Species: Homo sapiens (Human)
• Production Note: Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

Related Product Information for ATP4B recombinant protein

Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.

Product Categories/Family for ATP4B recombinant protein

Signal Transduction

References

"A C-terminal lobe of the beta subunit of Na,K-ATPase and H,K-ATPase resembles cell adhesion molecules." Bab-Dinitz E., Albeck S., Peleg Y., Brumfeld V., Gottschalk K.E., Karlish S.J. Biochemistry 48:8684-8691(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 4557339
• NCBI GeneID: 496
• NCBI Accession #: NP_000696.1
• NCBI GenBank Nucleotide #: NM_000705.3
• UniProt Accession #: P51164; B1B0N8
• Molecular Weight: 26.6 kDa
• NCBI Official Full Name: potassium-transporting ATPase subunit beta
• NCBI Official Synonym Full Names: ATPase H+/K+ transporting beta subunit
• NCBI Official Symbol: ATP4B
• NCBI Official Synonym Symbols: ATP6B
• NCBI Protein Information: potassium-transporting ATPase subunit beta
• UniProt Protein Name: Potassium-transporting ATPase subunit beta
• Protein Family: Potassium-transporting ATPase
• UniProt Gene Name: ATP4B

NCBI Description

The protein encoded by this gene belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes the beta subunit of the gastric H+, K+-ATPase. [provided by RefSeq, Jul 2008]

Uniprot Description

Required for stabilization and maturation of the catalytic proton pump alpha subunit and may also involved in cell adhesion and establishing epithelial cell polarity.