SDS-PAGE
Rho GDP-dissociation inhibitor 1 Recombinant Protein | ARHGDIA recombinant protein
Recombinant human Rho GDP-dissociation inhibitor 1 protein
Gene Names
ARHGDIA; GDIA1; RHOGDI; RHOGDI-1
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Rho GDP-dissociation inhibitor 1; Recombinant human Rho GDP-dissociation inhibitor 1 protein; Rho GDI 1; Rho-GDI alpha; ARHGDIA recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD
Applicable Applications for ARHGDIA recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for ARHGDIA recombinant protein
Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49 KD
NCBI Official Full Name
rho GDP-dissociation inhibitor 1 isoform a
NCBI Official Synonym Full Names
Rho GDP dissociation inhibitor (GDI) alpha
NCBI Official Symbol
ARHGDIA
NCBI Official Synonym Symbols
GDIA1; RHOGDI; RHOGDI-1
NCBI Protein Information
rho GDP-dissociation inhibitor 1; rho GDI 1; rho-GDI alpha
UniProt Protein Name
Rho GDP-dissociation inhibitor 1
Protein Family
UniProt Gene Name
ARHGDIA
UniProt Synonym Gene Names
GDIA1; Rho GDI 1
UniProt Entry Name
GDIR1_HUMAN
NCBI Description
Aplysia Ras-related homologs (ARHs), also called Rho genes, belong to the RAS gene superfamily encoding small guanine nucleotide exchange (GTP/GDP) factors. The ARH proteins may be kept in the inactive, GDP-bound state by interaction with GDP dissociation inhibitors, such as ARHGDIA (Leffers et al., 1993 [PubMed 8262133]).[supplied by OMIM, Jan 2009]
Uniprot Description
Function: Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them
By similarity.
Subunit structure: Monomer. Forms a heterodimer with RAC1
By similarity. Interacts with FER. Ref.17
Subcellular location: Cytoplasm.
Sequence similarities: Belongs to the Rho GDI family.
Research Articles on ARHGDIA
Similar Products
Product Notes
The ARHGDIA arhgdia (Catalog #AAA717203) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Rho GDP-dissociation inhibitor 1 can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the ARHGDIA arhgdia for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: AEQEPTAEQL AQIAAENEED EHSVNYKPPA QKSIQEIQEL DKDDESLRKY KEALLGRVAV SADPNVPNVV VTGLTLVCSS APGPLELDLT GDLESFKKQS FVLKEGVEYR IKISFRVNRE IVSGMKYIQH TYRKGVKIDK TDYMVGSYGP RAEEYEFLTP VEEAPKGMLA RGSYSIKSRF TDDDKTDHLS WEWNLTIKKD WKD. It is sometimes possible for the material contained within the vial of "Rho GDP-dissociation inhibitor 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
