Western Blot (WB)
(Western Blot detection against Immunogen (61.38kD).)
Mouse anti-Human PITX2 Monoclonal Antibody | anti-PITX2 antibody
PITX2 (Pituitary Homeobox 2, Paired-like Homeodomain Transcription Factor 2, Homeobox Protein PITX2, RIEG Bicoid-related Homeobox Transcription Factor, Solurshin, ALL1-responsive Protein ARP1, PITX2, ARP1, RGS, RIEG, RIEG1)
Reactivity
Human
Applications
ELISA, Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
PITX2; Monoclonal Antibody; PITX2 (Pituitary Homeobox 2; Paired-like Homeodomain Transcription Factor 2; Homeobox Protein PITX2; RIEG Bicoid-related Homeobox Transcription Factor; Solurshin; ALL1-responsive Protein ARP1; ARP1; RGS; RIEG; RIEG1); Anti -PITX2 (Pituitary Homeobox 2; anti-PITX2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G6
Specificity
Recognizes human PITX2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MNCMKGPLHLEHRAAGTKLSAVSSSSCHHPQPLAMASVLAPGQPRSLDSSKHRLEVHTISDTSSPEAAEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRPV
Applicable Applications for anti-PITX2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence, ELISA and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length recombinant corresponding to aa1-325 from human PITX2 (AAH13998) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (61.38kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (61.38kD).)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PITX2 on HeLa cell . [antibody concentration 10ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to PITX2 on HeLa cell . [antibody concentration 10ug/ml])
Testing Data
(Detection limit for recombinant GST tagged PITX2 is ~0.03ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged PITX2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-PITX2 antibody
Pilx2 is a member of the RIEG/PITX homeobox family, which is in the bicoid class of homeodomain proteins. This protein acts as a transcription factor and regulates procollagen lysyl hydroxylase gene expression. It plays a role in the terminal differentiation of somatotroph and lactotroph cell phenotypes, is involved in the development of the eye, tooth and abdominal organs, and acts as a transcriptional regulator involved in basal and hormone-regulated activity of prolactin. Mutations in this protein are associated with Axenfeld-Rieger syndrome, iridogoniodysgenesis syndrome, and sporadic cases of Peters anomaly. A similar protein in other vertebrates is involved in the determination of left-right asymmetry during development.
Product Categories/Family for anti-PITX2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36,558 Da
NCBI Official Full Name
pituitary homeobox 2
NCBI Official Synonym Full Names
paired-like homeodomain 2
NCBI Official Symbol
PITX2
NCBI Protein Information
pituitary homeobox 2; cPITX2; homeobox protein PITX2; transcription factor Pitx2; paired-like homeodomain transcription factor 2
UniProt Protein Name
Pituitary homeobox 2
Protein Family
UniProt Gene Name
PITX2
UniProt Synonym Gene Names
PTX2; cPITX2
UniProt Entry Name
PITX2_CHICK
Uniprot Description
Function: May play an important role in development and maintenance of anterior structures. May play a role in determining left-right asymmetry and in vasculogenesis during avian embryogenesis.
Subcellular location: Nucleus.
Sequence similarities: Belongs to the paired homeobox family. Bicoid subfamily.Contains 1 homeobox DNA-binding domain.
Research Articles on PITX2
Similar Products
Product Notes
The PITX2 pitx2 (Catalog #AAA644109) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PITX2 (Pituitary Homeobox 2, Paired-like Homeodomain Transcription Factor 2, Homeobox Protein PITX2, RIEG Bicoid-related Homeobox Transcription Factor, Solurshin, ALL1-responsive Protein ARP1, PITX2, ARP1, RGS, RIEG, RIEG1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PITX2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence, ELISA and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the PITX2 pitx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MNCMKGPLHL EHRAAGTKLS AVSSSSCHHP QPLAMASVLA PGQPRSLDSS KHRLEVHTIS DTSSPEAAEK DKSQQGKNED VGAEDPSKKK RQRRQRTHFT SQQLQELEAT FQRNRYPDMS TREEIAVWTN LTEARVRVWF KNRRAKWRKR ERNQQAELCK NGFGPQFNGL MQPYDDMYPG YSYNNWAAKG LTSASLSTKS FPFFNSMNVN PLSSQSMFSP PNSISSMSMS SSMVPSAVTG VPGSSLNSLN NLNNLSSPSL NSAVPTPACP YAPPTPPYVY RDTCNSSLAS LRLKAKQHSS FGYASVQNPA SNLSACQYAV DRPV. It is sometimes possible for the material contained within the vial of "PITX2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
