(Rhesus macaque) Amyloid beta A4 protein (APP) Recombinant Protein | APP recombinant protein
Recombinant Macaca mulatta (Rhesus macaque) Amyloid beta A4 protein (APP)
Gene Names
APP; ABPP
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
(Rhesus macaque) Amyloid beta A4 protein (APP); Recombinant Macaca mulatta (Rhesus macaque) Amyloid beta A4 protein (APP); Recombinant (Rhesus macaque) Amyloid beta A4 protein (APP); Amyloid beta A4 protein; ABPP; APP Alzheimer disease amyloid A4 protein homolog; APP recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-76
Sequence
EVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSVMSQSLRKTTREPLTRDPVKL
Sequence Length
76
Species
Macaca mulatta (Rhesus macaque)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
8,527 Da
NCBI Official Full Name
Amyloid beta A4 protein
NCBI Official Symbol
APP
NCBI Official Synonym Symbols
ABPP
NCBI Protein Information
amyloid beta A4 protein; amyloid beta (A4) precursor protein; alzheimer disease amyloid A4 protein homolog; amyloid beta (A4) precursor protein (peptidase nexin-II, Alzheimer disease)
UniProt Protein Name
Amyloid beta A4 protein
Protein Family
UniProt Gene Name
APP
UniProt Synonym Gene Names
APP
UniProt Entry Name
A4_MACMU
Uniprot Description
Function: Functional neuronal receptor which couples to intracellular signaling pathway through the GTP-binding protein G(O)
By similarity.
Subcellular location: Membrane; Single-pass type I membrane protein.
Sequence similarities: Belongs to the APP family.Contains 1 BPTI/Kunitz inhibitor domain.
Similar Products
Product Notes
The APP app (Catalog #AAA952361) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-76. The amino acid sequence is listed below: EVCSEQAETG PCRAMISRWY FDVTEGKCAP FFYGGCGGNR NNFDTEEYCM AVCGSVMSQS LRKTTREPLT RDPVKL. It is sometimes possible for the material contained within the vial of "(Rhesus macaque) Amyloid beta A4 protein (APP), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
