Apolipoprotein B-100 (APOB) Recombinant Protein | APOB recombinant protein

Recombinant Human Apolipoprotein B-100 (APOB) , partial

Cat. Num. AAA967958

• Gene Names: APOB; FLDB; LDLCQ4; apoB-48; apoB-100
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Apolipoprotein B-100 (APOB); Recombinant Human Apolipoprotein B-100 (APOB); partial; APOB recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-127 aa; Partial
• Sequence: EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

• Species: Human
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for APOB recombinant protein

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels.

NCBI and Uniprot Product Information

• NCBI GI #: 105990532
• NCBI GeneID: 338
• NCBI Accession #: NP_000375.2
• NCBI GenBank Nucleotide #: NM_000384.2
• UniProt Accession #: P04114; O00502; P78479; P78480; P78481; Q13779; Q13785; Q13786; Q13787; Q13788; Q4ZG63; Q53QC8
• Molecular Weight: 27.2
• NCBI Official Full Name: apolipoprotein B-100
• NCBI Official Synonym Full Names: apolipoprotein B
• NCBI Official Symbol: APOB
• NCBI Official Synonym Symbols: FLDB; LDLCQ4; apoB-48; apoB-100
• NCBI Protein Information: apolipoprotein B-100
• UniProt Protein Name: Apolipoprotein B-100
• Protein Family: Apolipoprotein
• UniProt Gene Name: APOB
• UniProt Synonym Gene Names: Apo B-100; Apo B-48

NCBI Description

This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver. The intestinal and the hepatic forms of apoB are encoded by a single gene from a single, very long mRNA. The two isoforms share a common N-terminal sequence. The shorter apoB-48 protein is produced after RNA editing of the apoB-100 transcript at residue 2180 (CAA->UAA), resulting in the creation of a stop codon, and early translation termination. Mutations in this gene or its regulatory region cause hypobetalipoproteinemia, normotriglyceridemic hypobetalipoproteinemia, and hypercholesterolemia due to ligand-defective apoB, diseases affecting plasma cholesterol and apoB levels. [provided by RefSeq, Jul 2008]

Uniprot Description

Apolipoprotein B is a major protein constituent of chylomicrons (apo B-48), LDL (apo B-100) and VLDL (apo B-100). Apo B-100 functions as a recognition signal for the cellular binding and internalization of LDL particles by the apoB/E receptor.