Annexin A1 (ANXA1) Recombinant Protein | ANXA1 recombinant protein
Recombinant Annexin A1 (ANXA1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A
Stability Test: The thermal stability is described by the loss rate of the targetprotein. The loss rate was determined by accelerated thermal degradation test,that is, incubate the protein at 37 degree C for 48h, and no obvious degradation andprecipitation were observed. (Referring from China Biological Products Standard,which was calculated by the Arrhenius equation.) The loss of this protein is lessthan 5% within the expiration date under appropriate storage condition.
NCBI and Uniprot Product Information
Uniprot Description
Function: Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It seems to bind from two to four calcium ions with high affinity.
Subunit structure: Homodimer in placenta (20%); linked by transglutamylation. Interacts with DYSF
By similarity.
Subcellular location: Nucleus. Cytoplasm. Cell projection › cilium. Basolateral cell membrane. Note: Found in the cilium, nucleus and basolateral cell membrane of ciliated cells in the tracheal endothelium. Found in the cytoplasm of type II pneumocytes and alveolar macrophages. Ref.2
Tissue specificity: In the lung, expressed in the ciliated cells of the tracheal endothelium, but not in the goblet cells. Expressed in type II pneumocytes and alveolar macrophages. Ref.2
Domain: A pair of annexin repeats may form one binding site for calcium and phospholipid.
Post-translational modification: Phosphorylated by protein kinase C, epidermal growth factor receptor/kinase and TRPM7. Phosphorylation results in loss of the inhibitory activity
By similarity.
Sequence similarities: Belongs to the annexin family.Contains 4 annexin repeats.
Similar Products
Product Notes
The ANXA1 anxa1 (Catalog #AAA2011769) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Annexin A1 (ANXA1) can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP). Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: The target protein is fused with two N-terminal Tags, His-tag and S-tag, its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A. It is sometimes possible for the material contained within the vial of "Annexin A1 (ANXA1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.