Guinea Pig anti-Rabbit Annexin A1 (ANXA1) Polyclonal Antibody | anti-ANXA1 antibody
Polyclonal Antibody to Annexin A1 (ANXA1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
NCBI and Uniprot Product Information
NCBI Description
This gene encodes a membrane-localized protein that binds phospholipids. This protein inhibits phospholipase A2 and has anti-inflammatory activity. Loss of function or expression of this gene has been detected in multiple tumors. [provided by RefSeq, Dec 2014]
Uniprot Description
ANXA1: a calcium/phospholipid-binding protein with which promotes membrane fusion and is involved in endocytosis. Has anti-inflammatory properties and inhibits phospholipase A2 activity. Accumulates on internalized vesicles after EGF-stimulated endocytosis, suggesting that it may be required for a late stage in inward vesiculation. Phosphorylated by PKC, EGFR and Chak1. Phosphorylation results in loss of the inhibitory activity. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.
Protein type: Calcium-binding; Lipid-binding
Chromosomal Location of Human Ortholog: 9q21.13
Cellular Component: extracellular space; mast cell granule; protein complex; focal adhesion; cell surface; basolateral plasma membrane; extracellular region; cornified envelope; cilium; mitochondrial membrane; cytoplasm; plasma membrane; nucleus; vesicle; endosome; sarcolemma
Molecular Function: protein binding, bridging; protein binding; protein homodimerization activity; single-stranded RNA binding; calcium-dependent phospholipid binding; phospholipase A2 inhibitor activity; double-stranded DNA-dependent ATPase activity; phospholipid binding; calcium ion binding; structural molecule activity; calcium-dependent protein binding; helicase activity; single-stranded DNA binding; receptor binding
Biological Process: prostate gland development; response to drug; response to peptide hormone stimulus; positive regulation of neutrophil apoptosis; gliogenesis; alpha-beta T cell differentiation; positive regulation of vesicle fusion; signal transduction; neutrophil homeostasis; arachidonic acid secretion; endocrine pancreas development; response to estradiol stimulus; DNA duplex unwinding; regulation of cell proliferation; keratinocyte differentiation; cell surface receptor linked signal transduction; insulin secretion; DNA strand renaturation; peptide cross-linking; inflammatory response; cell motility; negative regulation of apoptosis; positive regulation of prostaglandin biosynthetic process; response to X-ray
Research Articles on ANXA1
Similar Products
Product Notes
The ANXA1 anxa1 (Catalog #AAA2001507) is an Antibody produced from Guinea Pig and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Annexin A1 (ANXA1) reacts with Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Annexin A1 (ANXA1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A. It is sometimes possible for the material contained within the vial of "Annexin A1 (ANXA1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.