Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) ((Figure. Western Blot; Sample: Recombinant protein.))

Guinea Pig anti-Rabbit Annexin A1 (ANXA1) Polyclonal Antibody | anti-ANXA1 antibody

Polyclonal Antibody to Annexin A1 (ANXA1)

Gene Names
ANXA1; ANX1; LPC1
Reactivity
Rabbit
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Annexin A1 (ANXA1); Polyclonal Antibody; Polyclonal Antibody to Annexin A1 (ANXA1); anti-ANXA1 antibody
Ordering
For Research Use Only!
Host
Guinea Pig
Reactivity
Rabbit
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against ANXA1. It has been selected for its ability to recognize ANXA1 in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A
Sequence Length
346
Applicable Applications for anti-ANXA1 antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant ANXA1 (Lys214~Ala341) expressed in E.coli.
Cross Reactivity
Rabbit
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

((Figure. Western Blot; Sample: Recombinant protein.))

Western Blot (WB) ((Figure. Western Blot; Sample: Recombinant protein.))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
301
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,714 Da
NCBI Official Full Name
annexin A1
NCBI Official Synonym Full Names
annexin A1
NCBI Official Symbol
ANXA1
NCBI Official Synonym Symbols
ANX1; LPC1
NCBI Protein Information
annexin A1; p35; annexin-1; calpactin-2; calpactin II; lipocortin I; chromobindin-9; annexin I (lipocortin I); phospholipase A2 inhibitory protein
UniProt Protein Name
Annexin A1
Protein Family
UniProt Gene Name
ANXA1
UniProt Synonym Gene Names
ANX1; LPC1
UniProt Entry Name
ANXA1_HUMAN

NCBI Description

This gene encodes a membrane-localized protein that binds phospholipids. This protein inhibits phospholipase A2 and has anti-inflammatory activity. Loss of function or expression of this gene has been detected in multiple tumors. [provided by RefSeq, Dec 2014]

Uniprot Description

ANXA1: a calcium/phospholipid-binding protein with which promotes membrane fusion and is involved in endocytosis. Has anti-inflammatory properties and inhibits phospholipase A2 activity. Accumulates on internalized vesicles after EGF-stimulated endocytosis, suggesting that it may be required for a late stage in inward vesiculation. Phosphorylated by PKC, EGFR and Chak1. Phosphorylation results in loss of the inhibitory activity. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Calcium-binding; Lipid-binding

Chromosomal Location of Human Ortholog: 9q21.13

Cellular Component: extracellular space; mast cell granule; protein complex; focal adhesion; cell surface; basolateral plasma membrane; extracellular region; cornified envelope; cilium; mitochondrial membrane; cytoplasm; plasma membrane; nucleus; vesicle; endosome; sarcolemma

Molecular Function: protein binding, bridging; protein binding; protein homodimerization activity; single-stranded RNA binding; calcium-dependent phospholipid binding; phospholipase A2 inhibitor activity; double-stranded DNA-dependent ATPase activity; phospholipid binding; calcium ion binding; structural molecule activity; calcium-dependent protein binding; helicase activity; single-stranded DNA binding; receptor binding

Biological Process: prostate gland development; response to drug; response to peptide hormone stimulus; positive regulation of neutrophil apoptosis; gliogenesis; alpha-beta T cell differentiation; positive regulation of vesicle fusion; signal transduction; neutrophil homeostasis; arachidonic acid secretion; endocrine pancreas development; response to estradiol stimulus; DNA duplex unwinding; regulation of cell proliferation; keratinocyte differentiation; cell surface receptor linked signal transduction; insulin secretion; DNA strand renaturation; peptide cross-linking; inflammatory response; cell motility; negative regulation of apoptosis; positive regulation of prostaglandin biosynthetic process; response to X-ray

Research Articles on ANXA1

Similar Products

Product Notes

The ANXA1 anxa1 (Catalog #AAA2001507) is an Antibody produced from Guinea Pig and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Annexin A1 (ANXA1) reacts with Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Annexin A1 (ANXA1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-KGADVNV FTTILTTRSY LHLRRVFQKY SKYSQHDMNK VLDLELKGDI EKCLTAIVQC ATCKPAYFAE KLYQAMKGAG TRHKALIRIM VSRSEVDMND IKAFYQKKYG VSLCQAILDE TKGDYEKILV A. It is sometimes possible for the material contained within the vial of "Annexin A1 (ANXA1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.