Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Aminopeptidase N (Anpep) Recombinant Protein | Anpep recombinant protein

Recombinant Mouse Aminopeptidase N (Anpep) , partial

Gene Names
Anpep; Apn; AP-M; AP-N; Cd13; P150
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aminopeptidase N (Anpep); Recombinant Mouse Aminopeptidase N (Anpep); partial; Anpep recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
33-476; Provide the fragment at the extracellular domain
Sequence
YAQEKNRNAENSATAPTLPGSTSATTATTTPAVDESKPWNQYRLPKTLIPDSYRVILR PYLTPNNQGLYIFQGNSTVRFTCNQTTDVIIIHSKKLNYTLKGNHRVVLRTLDGTPAPNI DKTELVERTEYLVVHLQGSLVEGRQYEMDSQFQGELADDLAGFYRSEYMEGDVKK VVATTQMQAADARKSFPCFDEPAMKAMFNITLIYPNNLIALSNMLPKESKPYPEDPS CTMTEFHSTPKMSTYLLAYIVSEFKNISSVSANGVQIGIWARPSAIDEGQGDYALNVT GPILNFFAQHYNTSYPLPKSDQIALPDFNAGAMENWGLVTYRESSLVFDSQSSSISN KERVVTVIAHELAHQWFGNLVTVAWWNDLWLNEGFASYVEYLGADYAEPTWNLKD LMVLNDVYRVMAVDALASSHPLSSPADEIKTPDQIMELFDSITY
Sequence Length
476
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Anpep recombinant protein
Aminopeptidase N is located in the small-intestinal and renal microvillar membrane, and also in other plasma membranes. In the small intestine aminopeptidase N plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Its function in proximal tubular epithelial cells and other cell types is less clear. The large extracellular carboxyterminal domain contains a pentapeptide consensus sequence characteristic of members of the zinc-binding metalloproteinase superfamily. Sequence comparisons with known enzymes of this class showed that CD13 and aminopeptidase N are identical. The latter enzyme was thought to be involved in the metabolism of regulatory peptides by diverse cell types, including small intestinal and renal tubular epithelial cells, macrophages, granulocytes, and synaptic membranes from the CNS. Human aminopeptidase N is a receptor for one strain of human coronavirus that is an important cause of upper respiratory tract infections. Defects in this gene appear to be a cause of various types of leukemia or lymphoma.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109,651 Da
NCBI Official Full Name
aminopeptidase N
NCBI Official Synonym Full Names
alanyl (membrane) aminopeptidase
NCBI Official Symbol
Anpep
NCBI Official Synonym Symbols
Apn; AP-M; AP-N; Cd13; P150
NCBI Protein Information
aminopeptidase N
UniProt Protein Name
Aminopeptidase N
Protein Family
UniProt Gene Name
Anpep
UniProt Synonym Gene Names
Lap-1; Lap1; AP-N; mAPN; AP-M

Uniprot Description

Broad specificity aminopeptidase which plays a role in the final digestion of peptides generated from hydrolysis of proteins by gastric and pancreatic proteases. Also involved in the processing of various peptides including peptide hormones, such as angiotensin III and IV, neuropeptides, and chemokines (). May also be involved the cleavage of peptides bound to major histocompatibility complex class II molecules of antigen presenting cells (PubMed:8691132). May have a role in angiogenesis and promote cholesterol crystallization ().

Research Articles on Anpep

Similar Products

Product Notes

The Anpep anpep (Catalog #AAA964199) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 33-476; Provide the fragment at the extracellular domain. The amino acid sequence is listed below: YAQEKNRNAE NSATAPTLPG STSATTATTT PAVDESKPWN QYRLPKTLIP DSYRVILR PYLTPNNQGL YIFQGNSTVR FTCNQTTDVI IIHSKKLNYT LKGNHRVVLR TLDGTPAPNI DKTELVERTE YLVVHLQGSL VEGRQYEMDS QFQGELADDL AGFYRSEYME GDVKK VVATTQMQAA DARKSFPCFD EPAMKAMFNI TLIYPNNLIA LSNMLPKESK PYPEDPS CTMTEFHSTP KMSTYLLAYI VSEFKNISSV SANGVQIGIW ARPSAIDEGQ GDYALNVT GPILNFFAQH YNTSYPLPKS DQIALPDFNA GAMENWGLVT YRESSLVFDS QSSSISN KERVVTVIAH ELAHQWFGNL VTVAWWNDLW LNEGFASYVE YLGADYAEPT WNLKD LMVLNDVYRV MAVDALASSH PLSSPADEIK TPDQIMELFD SITY. It is sometimes possible for the material contained within the vial of "Aminopeptidase N (Anpep), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.