Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

GDP-Man: Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (Alg11) Recombinant Protein | Alg11 recombinant protein

Recombinant Mouse GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (Alg11)

Gene Names
Alg11; AI849156; AW492253; Mmat-4(5); B230397C21
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
GDP-Man: Man(3)GlcNAc(2)-PP-Dol alpha-1; 2-mannosyltransferase (Alg11); Recombinant Mouse GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1; Alg11 recombinant protein
Ordering
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
1-492aa; full length protein
Sequence
MAADTGSWCVYAVLRFFYSLFFPGLMICGVLCVYLVIGLWVIRWHLQRKKKSVSTSKNGK EQTVVAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDINVSGQQILDGAFRRF NIKLAHPVQFVFLRKRYLVEDSRYPHFTLLGQSLGSILLGWEALMQRVPDVYIDSMGYAF TLPLFKYVGGCRVGSYVHYPTISTDMLSVVKNQNPGFNNAAFISRNALLSKAKLIYYYLF AFVYGLVGSCSDIVMVNSSWTLNHILSLWKVGHCTNIVYPPCDVQTFLDIPLHEKKVTPG HLLVSIGQFRPEKNHALQIKAFAKLLNEKAAELGHSLKLVLIGGCRNKDDEFRVNQLRSL SENLGVQENVEFKINISFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTVILAHNSG GPKLDIVIPHEGQITGFLAESEEGYADSMAHILSLSAEERLQIRKNARASISRFSDQEFE VAFLCSMEKLLT
Sequence Length
Full length protein
Application Notes
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Species
Mouse
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Product Categories/Family for Alg11 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,597 Da
NCBI Official Full Name
GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase isoform 1
NCBI Official Synonym Full Names
asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase)
NCBI Official Symbol
Alg11
NCBI Official Synonym Symbols
AI849156; AW492253; Mmat-4(5); B230397C21
NCBI Protein Information
GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
UniProt Protein Name
GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase
UniProt Gene Name
Alg11
UniProt Entry Name
ALG11_MOUSE

Uniprot Description

ALG11: Mannosyltransferase involved in the last steps of the synthesis of Man5GlcNAc(2)-PP-dolichol core oligosaccharide on the cytoplasmic face of the endoplasmic reticulum. Catalyzes the addition of the 4th and 5th mannose residues to the dolichol- linked oligosaccharide chain. Defects in ALG11 are the cause of congenital disorder of glycosylation type 1P (CDG1P). A multisystem disorder caused by a defect in glycoprotein biosynthesis and characterized by under-glycosylated serum glycoproteins. Congenital disorders of glycosylation result in a wide variety of clinical features, such as defects in the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions. Belongs to the glycosyltransferase group 1 family. Glycosyltransferase 4 subfamily.

Protein type: EC 2.4.1.131; Membrane protein, integral; Membrane protein, multi-pass; Transferase; Glycan Metabolism - N-glycan biosynthesis

Cellular Component: endoplasmic reticulum; integral to membrane; membrane

Molecular Function: glycolipid 2-alpha-mannosyltransferase activity; transferase activity; transferase activity, transferring glycosyl groups

Research Articles on Alg11

Similar Products

Product Notes

The Alg11 alg11 (Catalog #AAA7007678) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-492aa; full length protein. This is a recombinant transmembrane protein expressed in a cell-free expression system. Researchers should empirically determine the suitability of the Alg11 alg11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAADTGSWCV YAVLRFFYSL FFPGLMICGV LCVYLVIGLW VIRWHLQRKK KSVSTSKNGK EQTVVAFFHP YCNAGGGGER VLWCALRALQ KKYPEAVYVV YTGDINVSGQ QILDGAFRRF NIKLAHPVQF VFLRKRYLVE DSRYPHFTLL GQSLGSILLG WEALMQRVPD VYIDSMGYAF TLPLFKYVGG CRVGSYVHYP TISTDMLSVV KNQNPGFNNA AFISRNALLS KAKLIYYYLF AFVYGLVGSC SDIVMVNSSW TLNHILSLWK VGHCTNIVYP PCDVQTFLDI PLHEKKVTPG HLLVSIGQFR PEKNHALQIK AFAKLLNEKA AELGHSLKLV LIGGCRNKDD EFRVNQLRSL SENLGVQENV EFKINISFDE LKNYLSEATI GLHTMWNEHF GIGVVECMAA GTVILAHNSG GPKLDIVIPH EGQITGFLAE SEEGYADSMA HILSLSAEER LQIRKNARAS ISRFSDQEFE VAFLCSMEKL LT. It is sometimes possible for the material contained within the vial of "GDP-Man: Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase (Alg11), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.