Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Proteasomal ubiquitin receptor ADRM1 (Adrm1) Recombinant Protein | Adrm1 recombinant protein

Recombinant Mouse Proteasomal ubiquitin receptor ADRM1 (Adrm1)

Gene Names
Adrm1; Arm1; ARM-1; Gp110; Rpn13; AA408205; AU043535; 1110063P18Rik; 2510006J17Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Proteasomal ubiquitin receptor ADRM1 (Adrm1); Recombinant Mouse Proteasomal ubiquitin receptor ADRM1 (Adrm1); Adrm1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-407, full length protein
Sequence
TTSGALFPSLVPGSRGSSTKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGTVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNECLNNPPMPGSLGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPASSSSSSSRSQSAAVTPSSSTSSARATPAPSAPAAASATSPSPAPSSGNGTSTAASPTQPIQLSDLQSILATMNVPAGPGGSQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKSDPKEGDTKDKKDEEEDMSLD
Sequence Length
406
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Adrm1 recombinant protein
This protein is an integral plasma membrane protein which promotes cell adhesion. The encoded protein is thought to undergo O-linked glycosylation. Expression of this gene has been shown to be induced by gamma interferon in some cancer cells. Two transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,060 Da
NCBI Official Full Name
proteasomal ubiquitin receptor ADRM1
NCBI Official Synonym Full Names
adhesion regulating molecule 1
NCBI Official Symbol
Adrm1
NCBI Official Synonym Symbols
Arm1; ARM-1; Gp110; Rpn13; AA408205; AU043535; 1110063P18Rik; 2510006J17Rik
NCBI Protein Information
proteasomal ubiquitin receptor ADRM1
UniProt Protein Name
Proteasomal ubiquitin receptor ADRM1
UniProt Gene Name
Adrm1
UniProt Synonym Gene Names
Gp110; Gp110; ARM-1

Uniprot Description

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair. Within the complex, functions as a proteasomal ubiquitin receptor. Engages and thus activates 19S-associated deubiquitinases UCHL5 and PSMD14 during protein degradation. UCHL5 reversibly associate with the 19S regulatory particle whereas PSMD14 is an intrinsic subunit of the proteasome lid subcomplex.

Research Articles on Adrm1

Similar Products

Product Notes

The Adrm1 adrm1 (Catalog #AAA1401437) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-407, full length protein. The amino acid sequence is listed below: TTSGALFPSL VPGSRGSSTK YLVEFRAGKM SLKGTTVTPD KRKGLVYIQQ TDDSLIHFCW KDRTSGTVED DLIIFPDDCE FKRVPQCPSG RVYVLKFKAG SKRLFFWMQE PKTDQDEEHC RKVNECLNNP PMPGSLGASG SSGHELSALG GEGGLQSLLG NMSHSQLMQL IGPAGLGGLG GLGALTGPGL ASLLGSSGPP ASSSSSSSRS QSAAVTPSSS TSSARATPAP SAPAAASATS PSPAPSSGNG TSTAASPTQP IQLSDLQSIL ATMNVPAGPG GSQQVDLASV LTPEIMAPIL ANADVQERLL PYLPSGESLP QTADEIQNTL TSPQFQQALG MFSAALASGQ LGPLMCQFGL PAEAVEAANK GDVEAFAKAM QNNAKSDPKE GDTKDKKDEE EDMSLD. It is sometimes possible for the material contained within the vial of "Proteasomal ubiquitin receptor ADRM1 (Adrm1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.