Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SMG1 monoclonal antibody (M05), clone 4E4 Western Blot analysis of SMG1 expression in Hela S3 NE (Cat # L013V3).)

Mouse SMG1 Monoclonal Antibody | anti-SMG1 antibody

SMG1 (SMG1 Homolog, Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans), 61E3.4, ATX, KIAA0421, LIP) (PE)

Gene Names
SLK; LOSK; STK2; se20-9; bA16H23.1
Applications
Western Blot
Purity
Purified
Synonyms
SMG1; Monoclonal Antibody; SMG1 (SMG1 Homolog; Phosphatidylinositol 3-Kinase-Related Kinase (C. elegans); 61E3.4; ATX; KIAA0421; LIP) (PE); SMG1 Homolog; LIP; anti-SMG1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
40000
Specificity
Recognizes SMG1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SMG1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SMG1 (NP_055535, 2922aa-3031aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SMG1 monoclonal antibody (M05), clone 4E4 Western Blot analysis of SMG1 expression in Hela S3 NE (Cat # L013V3).)

Western Blot (WB) (SMG1 monoclonal antibody (M05), clone 4E4 Western Blot analysis of SMG1 expression in Hela S3 NE (Cat # L013V3).)

Testing Data

(Detection limit for recombinant GST tagged SMG1 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SMG1 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SMG1 antibody
This gene encodes a protein involved in nonsense-mediated mRNA decay (NMD) as part of the mRNA surveillance complex. The protein has kinase activity and is thought to function in NMD by phosphorylating the regulator of nonsense transcripts 1 protein. Alternative spliced transcript variants have been described, but their full-length natures have not been determined. [provided by RefSeq]
Product Categories/Family for anti-SMG1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
138,996 Da
NCBI Official Full Name
STE20-like serine/threonine-protein kinase isoform 1
NCBI Official Synonym Full Names
STE20-like kinase
NCBI Official Symbol
SLK
NCBI Official Synonym Symbols
LOSK; STK2; se20-9; bA16H23.1
NCBI Protein Information
STE20-like serine/threonine-protein kinase; CTCL tumor antigen se20-9; Long Ste20-like Kinase; SNF1 (sucrose nonfermenting, yeast, homolog)-like kinase, SNF1 sucrose nonfermenting like kinase; STE20-related kinase; STE20-related serine/threonine-protein k
UniProt Protein Name
STE20-like serine/threonine-protein kinase
UniProt Gene Name
SLK
UniProt Synonym Gene Names
KIAA0204; STK2; STE20-like kinase; hSLK
UniProt Entry Name
SLK_HUMAN

Uniprot Description

SLK: a microtubule-associated protein kinase required for progression through G2. Co-localizes with the mitotic spindle in cells undergoing mitosis. Regulates actin reorganization during cell adhesion and spreading via a Rac1-mediated pathway. Signals via ASK1 and p38 to promote apoptosis. Activated in response to anoxia and ischemia-reperfusion injury in cell culture. It inhibits the protective aspects of the endoplasmic reticulum stress response, thus contributing to its proapoptotic effect. Two alternatively-spliced isoforms have been described.

Protein type: Protein kinase, STE; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; STE group; STE20 family; SLK subfamily

Chromosomal Location of Human Ortholog: 10q24.33

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; identical protein binding; protein homodimerization activity; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: apoptosis; protein amino acid autophosphorylation

Similar Products

Product Notes

The SMG1 slk (Catalog #AAA6185603) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SMG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SMG1 slk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SMG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.