Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Alpha-1B adrenergic receptor (ADRA1B) Recombinant Protein | ADRA1B recombinant protein

Recombinant Dog Alpha-1B adrenergic receptor (ADRA1B)

Gene Names
ADRA1B; RDC5
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Alpha-1B adrenergic receptor (ADRA1B); Recombinant Dog Alpha-1B adrenergic receptor (ADRA1B); Recombinant Alpha-1B adrenergic receptor (ADRA1B); Alpha-1B adrenergic receptor; Alpha-1B adrenoreceptor; Alpha-1B adrenoceptor; ADRA1B recombinant protein
Ordering
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-417
Sequence
VLPFSAALEVLGYWVLGRIFCDIWAAVDVLCCTASILSLCAISIDRYIGVRYSLQYPTLVTRRKAILALLGVWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAVILVMYCRVYIVAKRTTKNLEAGVMKEMSNSKELTLRIHSKNFHEDTLSSTKAKGHNPRSSIAVKLFKFSREKKAAKTLGIVVGMFILCWLPFFIALPLGSLFSTLKPPDAVFKVVFWLGYFNSCLNPIIYPCSSKEFKRAFVRILGCQCRGRRRRRRRRRLGGCAYTYRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRAAPPPVELCAVPEWKAPGALLSLPAPQPPGRRGRRDSGPLFTFRLLAERGSPAAGDGACRPAPDAANGQPGFKTNMPLAPGQF
Sequence Length
515
Species
Canis familiaris (Dog) (Canis lupus familiaris)
Preparation and Storage
Store at -20 degree C. For extended storage, store at -20 or -80 degree C.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,892 Da
NCBI Official Full Name
alpha-1B adrenergic receptor
NCBI Official Symbol
ADRA1B
NCBI Official Synonym Symbols
RDC5
NCBI Protein Information
alpha-1B adrenergic receptor; alpha-1B adrenoceptor; alpha-1B adrenoreceptor; adrenergic, alpha-1B-, receptor
UniProt Protein Name
Alpha-1B adrenergic receptor
UniProt Gene Name
ADRA1B
UniProt Synonym Gene Names
RDC5; Alpha-1B adrenoceptor
UniProt Entry Name
ADA1B_CANFA

Uniprot Description

Function: This alpha-adrenergic receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Its effect is mediated by G(q) and G(11) proteins. Nuclear ADRA1A-ADRA1B heterooligomers regulate phenylephrine (PE)-stimulated ERK signaling in cardiac myocytes

By similarity.

Subunit structure: Homo- and heterooligomer

By similarity. Heterooligomerizes with ADRA1B homooligomers in cardiac myocytes

By similarity.

Subcellular location: Nucleus membrane; Multi-pass membrane protein

By similarity. Cell membrane; Multi-pass membrane protein

By similarity. Note: Location at the nuclear membrane facilitates heterooligomerization and regulates ERK-mediated signaling in cardiac myocytes. Colocalizes with GNAQ, PLCB1 as well as LAP2 at the nuclear membrane of cardiac myocytes

By similarity.

Sequence similarities: Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA1B sub-subfamily.

Similar Products

Product Notes

The ADRA1B adra1b (Catalog #AAA961054) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-417. The amino acid sequence is listed below: VLPFSAALEV LGYWVLGRIF CDIWAAVDVL CCTASILSLC AISIDRYIGV RYSLQYPTLV TRRKAILALL GVWVLSTVIS IGPLLGWKEP APNDDKECGV TEEPFYALFS SLGSFYIPLA VILVMYCRVY IVAKRTTKNL EAGVMKEMSN SKELTLRIHS KNFHEDTLSS TKAKGHNPRS SIAVKLFKFS REKKAAKTLG IVVGMFILCW LPFFIALPLG SLFSTLKPPD AVFKVVFWLG YFNSCLNPII YPCSSKEFKR AFVRILGCQC RGRRRRRRRR RLGGCAYTYR PWTRGGSLER SQSRKDSLDD SGSCLSGSQR TLPSASPSPG YLGRAAPPPV ELCAVPEWKA PGALLSLPAP QPPGRRGRRD SGPLFTFRLL AERGSPAAGD GACRPAPDAA NGQPGFKTNM PLAPGQF. It is sometimes possible for the material contained within the vial of "Alpha-1B adrenergic receptor (ADRA1B), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.