Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Adiponectin receptor protein 1 (ADIPOR1) Recombinant Protein | ADIPOR1 recombinant protein

Recombinant Human Adiponectin receptor protein 1 (ADIPOR1), partial

Gene Names
ADIPOR1; CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Adiponectin receptor protein 1 (ADIPOR1); Recombinant Human Adiponectin receptor protein 1 (ADIPOR1); partial; Adiponectin receptor protein 1(Progestin and adipoQ receptor family member 1)(Progestin and adipoQ receptor family member I); ADIPOR1 recombinant protein
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Cell Free Expression
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
89-375aa, Partial
Sequence
EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Species
Homo sapiens (Human)
Relevance
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism (PubMed:25855295, PubMed:12802337). Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin (By similarity).
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20 degree C/-80 degree C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ADIPOR1 recombinant protein
This is a recombinant transmembrane protein expressed in a cell-free expression system.
Product Categories/Family for ADIPOR1 recombinant protein
References
"PAQR proteins: a novel membrane receptor family defined by an ancient 7-transmembrane pass motif."Tang Y.T., Hu T., Arterburn M., Boyle B., Bright J.M., Emtage P.C., Funk W.D.J. Mol. Evol. 61:372-380(2005)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
375
NCBI Official Full Name
Adiponectin receptor protein 1
NCBI Official Synonym Full Names
adiponectin receptor 1
NCBI Official Symbol
ADIPOR1
NCBI Official Synonym Symbols
CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A
NCBI Protein Information
adiponectin receptor protein 1; progestin and adipoQ receptor family member I
UniProt Protein Name
Adiponectin receptor protein 1
UniProt Gene Name
ADIPOR1
UniProt Synonym Gene Names
PAQR1; TESBP1A
UniProt Entry Name
ADR1_HUMAN

NCBI Description

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]

Uniprot Description

ADIPOR1: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin. Belongs to the ADIPOR family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function: adiponectin binding; identical protein binding; hormone binding; protein heterodimerization activity; receptor activity; protein kinase binding

Biological Process: hormone-mediated signaling; adiponectin-mediated signaling pathway; positive regulation of JAK-STAT cascade; fatty acid oxidation; negative regulation of cell growth; positive regulation of insulin receptor signaling pathway; leptin-mediated signaling pathway

Research Articles on ADIPOR1

Similar Products

Product Notes

The ADIPOR1 adipor1 (Catalog #AAA9018448) is a Recombinant Protein produced from Cell Free Expression and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 89-375aa, Partial. The amino acid sequence is listed below: EGRWRVIPYD VLPDWLKDND YLLHGHRPPM PSFRACFKSI FRIHTETGNI WTHLLGFVLF LFLGILTMLR PNMYFMAPLQ EKVVFGMFFL GAVLCLSFSW LFHTVYCHSE KVSRTFSKLD YSGIALLIMG SFVPWLYYSF YCSPQPRLIY LSIVCVLGIS AIIVAQWDRF ATPKHRQTRA GVFLGLGLSG VVPTMHFTIA EGFVKATTVG QMGWFFLMAV MYITGAGLYA ARIPERFFPG KFDIWFQSHQ IFHVLVVAAA FVHFYGVSNL QEFRYGLEGG CTDDTLL. It is sometimes possible for the material contained within the vial of "Adiponectin receptor protein 1 (ADIPOR1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual