Aminoacylase-1 (Acy1) Recombinant Protein | Acy1 recombinant protein
Recombinant Mouse Aminoacylase-1 (Acy1)
Gene Names
Acy1; Acy-1; 1110014J22Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Aminoacylase-1 (Acy1); Recombinant Mouse Aminoacylase-1 (Acy1); Acy1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-408, full length protein
Sequence
TTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES
Sequence Length
407
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Acy1 recombinant protein
Aminoacylase-1 is a cytosolic, homodimeric, zinc-binding enzyme that catalyzes the hydrolysis of acylated L-amino acids to L-amino acids and acyl group, and has been postulated to function in the catabolism and salvage of acylated amino acids. ACY1 has been assigned to chromosome 3p21.1, a region reduced to homozygosity in small-cell lung cancer (SCLC), and its expression has been reported to be reduced or undetectable in SCLC cell lines and tumors. The amino acid sequence of human aminoacylase-1 is highly homologous to the porcine counterpart, and ACY1 is the first member of a new family of zinc-binding enzymes.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,781 Da
NCBI Official Full Name
aminoacylase-1
NCBI Official Synonym Full Names
aminoacylase 1
NCBI Official Symbol
Acy1
NCBI Official Synonym Symbols
Acy-1; 1110014J22Rik
NCBI Protein Information
aminoacylase-1
UniProt Protein Name
Aminoacylase-1
Protein Family
UniProt Gene Name
Acy1
UniProt Synonym Gene Names
ACY-1
Uniprot Description
Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
Similar Products
Product Notes
The Acy1 acy1 (Catalog #AAA1332560) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-408, full length protein. The amino acid sequence is listed below: TTKDPESEHP SVTLFRQYLR ICTVQPNPDY GGAITFLEER ARQLGLSCQK IEVVPGFVIT VLTWPGTNPS LPSILLNSHT DVVPVFKEHW HHDPFEAFKD SEGYIYARGS QDMKSVSIQY LEAVRRLKSE GHRFPRTIHM TFVPDEEVGG HKGMELFVKR PEFQALRAGF ALDEGLANPT DAFTVFYSER SPWWVRVTST GKPGHASRFI EDTAAEKLHK VISSILAFRE KERQRLQANP HLKEGAVTSV NLTKLEGGVA YNVVPATMSA SFDFRVAPDV DMKAFEKQLQ RWCQEAGEGV TFEFAQKFTE PRMTPTDDSD PWWAAFSGAC KAMNLTLEPE IFPAATDSRY IRAVGIPALG FSPMNRTPVL LHDHNERLHE DIFLRGVDIY TGLLSALASV PTLPGES. It is sometimes possible for the material contained within the vial of "Aminoacylase-1 (Acy1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
