Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: HSPA1LSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse HSPA1L Polyclonal Antibody | anti-HSPA1L antibody

HSPA1L Antibody-middle region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HSPA1L; Polyclonal Antibody; HSPA1L Antibody-middle region; heat shock 70kDa protein 1-like; Msh5; Hsc70t; anti-HSPA1L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
LLQDYFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAP
Applicable Applications for anti-HSPA1L antibody
Western Blot (WB)
Protein Size
641 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse HSPA1L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: HSPA1LSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: HSPA1LSample Tissue: Mouse NIH3T3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-HSPA1L antibody
Description of Target: Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. Positive regulator of PRKN translocation to damaged mitochondria.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
70kDa
UniProt Protein Name
Heat shock 70 kDa protein 1-like
Protein Family
UniProt Gene Name
Hspa1l
UniProt Synonym Gene Names
Hsc70t; Heat shock 70 kDa protein 1L
UniProt Entry Name
HS71L_MOUSE

Uniprot Description

HSPA1L: In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Not induced by heat shock. Expressed in spermatids. Belongs to the heat shock protein 70 family.

Protein type: Heat shock protein; Chaperone; Mitochondrial

Cellular Component: signalosome; cytosol

Molecular Function: unfolded protein binding; nucleotide binding; ATP binding

Biological Process: binding of sperm to zona pellucida; multicellular organismal development; spermatogenesis; protein refolding; cell differentiation

Similar Products

Product Notes

The HSPA1L hspa1l (Catalog #AAA3249808) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HSPA1L Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's HSPA1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HSPA1L hspa1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LLQDYFNGRD LNKSINPDEA VAYGAAVQAA ILMGDKSEKV QDLLLLDVAP. It is sometimes possible for the material contained within the vial of "HSPA1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.