Acyl-coenzyme A thioesterase 10, mitochondrial (Acot10) Recombinant Protein | Acot10 recombinant protein
Recombinant Mouse Acyl-coenzyme A thioesterase 10, mitochondrial (Acot10)
Gene Names
Acot10; p48; Acate3; MT-ACT48
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acyl-coenzyme A thioesterase 10; mitochondrial (Acot10); Recombinant Mouse Acyl-coenzyme A thioesterase 10; Acot10 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-439, full length protein
Sequence
LSQGSQYKISEPLHIHQVQVKLREIVGISTVWRDHVQAMEERKLLHSFLPKSQKVLPPRKIRDSYIEVLLPLGTDPELRDKYVTVQNTVRFGRILEDLDSLGVLVCYMHNHNHSTNMSLLSIVTVLVDKIDMCKHSLSPEQDIKFTGHVSWVGNTTMEVKMKMFQLHDDETYWPVLDATFVMVAQDSENKRPAFVNPLIPENKEEEELFTQGELNKSRRIAFSTSSLLKVAPSSEERNIIHELFLSTLDPKTISFQSRILPPKAVWMEDTKLKSLDICHPQERNVFNRIFGGFLMRKAYELAWATACSFGGSRPYVVTVDDIMFQKPVEVGSLLFLSSQVCFTQGNYIQVRVHSEVFSLDSREHMTTNVFHFTFMSEKEVPLIFPKTYGESMLYLDGQRHFKSMSTPVTLKKDYPVEP
Sequence Length
418
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,552 Da
NCBI Official Full Name
acyl-coenzyme A thioesterase 10, mitochondrial
NCBI Official Synonym Full Names
acyl-CoA thioesterase 10
NCBI Official Symbol
Acot10
NCBI Official Synonym Symbols
p48; Acate3; MT-ACT48
NCBI Protein Information
acyl-coenzyme A thioesterase 10, mitochondrial
UniProt Protein Name
Acyl-coenzyme A thioesterase 10, mitochondrial
Protein Family
UniProt Gene Name
Acot10
UniProt Synonym Gene Names
Acyl-CoA thioesterase 10; Mt-ACT48.2
Uniprot Description
Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Active on long chain acyl-CoAs.
Similar Products
Product Notes
The Acot10 acot10 (Catalog #AAA1482289) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-439, full length protein. The amino acid sequence is listed below: LSQGSQYKIS EPLHIHQVQV KLREIVGIST VWRDHVQAME ERKLLHSFLP KSQKVLPPRK IRDSYIEVLL PLGTDPELRD KYVTVQNTVR FGRILEDLDS LGVLVCYMHN HNHSTNMSLL SIVTVLVDKI DMCKHSLSPE QDIKFTGHVS WVGNTTMEVK MKMFQLHDDE TYWPVLDATF VMVAQDSENK RPAFVNPLIP ENKEEEELFT QGELNKSRRI AFSTSSLLKV APSSEERNII HELFLSTLDP KTISFQSRIL PPKAVWMEDT KLKSLDICHP QERNVFNRIF GGFLMRKAYE LAWATACSFG GSRPYVVTVD DIMFQKPVEV GSLLFLSSQV CFTQGNYIQV RVHSEVFSLD SREHMTTNVF HFTFMSEKEV PLIFPKTYGE SMLYLDGQRH FKSMSTPVTL KKDYPVEP. It is sometimes possible for the material contained within the vial of "Acyl-coenzyme A thioesterase 10, mitochondrial (Acot10), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
