ATP-binding cassette sub-family A member 1 (Abca1) Recombinant Protein | Abca1 recombinant protein

Recombinant Mouse ATP-binding cassette sub-family A member 1 (Abca1) , partial

• Gene Names: Abca1; Abc1; ABC-1
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: ATP-binding cassette sub-family A member 1 (Abca1); Recombinant Mouse ATP-binding cassette sub-family A member 1 (Abca1); partial; Abca1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1372-1656aa; Partial, provide one of the two extracellulr domains
• Sequence: GKYPSLELQPWMYNEQYTFVSNDAPEDMGTQELLNALTKDPGFGTRCMEGNPIPDTPCLAGEEDWTISPVPQSIVDLFQNGNWTMKNPSPACQCSSDKIKKMLPVCPPGAGGLPPPQRKQKTADILQNLTGRNISDYLVKTYVQIIAKSLKNKIWVNEFRYGGFSLGVSNSQALPPSHEVNDAIKQMKKLLKLTKDSSADRFLSSLGRFMAGLDTKNNVKVWFNNKGWHAISSFLNVINNAILRANLQKGENPSQYGITAFNHPLNLTKQQLSEVALMTTSVDVL

• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 90568038
• NCBI GeneID: 11303
• NCBI Accession #: NP_038482.3
• NCBI GenBank Nucleotide #: NM_013454.3
• UniProt Accession #: P41233; B1AWZ8
• Molecular Weight: 253,912 Da
• NCBI Official Full Name: ATP-binding cassette sub-family A member 1
• NCBI Official Synonym Full Names: ATP-binding cassette, sub-family A (ABC1), member 1
• NCBI Official Symbol: Abca1
• NCBI Official Synonym Symbols: Abc1; ABC-1
• NCBI Protein Information: ATP-binding cassette sub-family A member 1
• UniProt Protein Name: ATP-binding cassette sub-family A member 1
• Protein Family: ABC transporter A family
• UniProt Gene Name: Abca1
• UniProt Synonym Gene Names: Abc1; ABC-1; ATP-binding cassette 1

NCBI Description

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. In humans, this protein functions as a cholesterol efflux pump in the cellular lipid removal pathway. Mutations in the human gene have been associated with Tangier's disease and familial high-density lipoprotein deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport ().