Ubiquitin fusion degradation protein 1 homolog (Ufd1l) Recombinant Protein | Ufd1l recombinant protein

Recombinant Mouse Ubiquitin fusion degradation protein 1 homolog (Ufd1l)

Cat. Num. AAA967600

• Gene Names: Ufd1; Ufd1l
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ubiquitin fusion degradation protein 1 homolog (Ufd1l); Recombinant Mouse Ubiquitin fusion degradation protein 1 homolog (Ufd1l); Ufd1l recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-307 , Full length protein
• Sequence: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP
• Sequence Length: 307

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

Related Product Information for Ufd1l recombinant protein

This protein forms a complex with two other proteins, nuclear protein localization-4 and valosin-containing protein, and this complex is necessary for the degradation of ubiquitinated proteins. In addition, this complex controls the disassembly of the mitotic spindle and the formation of a closed nuclear envelope after mitosis. Mutations in this gene have been associated with Catch 22 syndrome as well as cardiac and craniofacial defects. Alternative splicing results in multiple transcript variants encoding different isoforms. A related pseudogene has been identified on chromosome 18.

NCBI and Uniprot Product Information

• NCBI GI #: 257153392
• NCBI GeneID: 22230
• NCBI Accession #: NP_035802.3
• NCBI GenBank Nucleotide #: NM_011672.4
• UniProt Accession #: P70362; Q923C4
• Molecular Weight: 34,481 Da
• NCBI Official Full Name: ubiquitin recognition factor in ER-associated degradation protein 1
• NCBI Official Synonym Full Names: ubiquitin recognition factor in ER-associated degradation 1
• NCBI Official Symbol: Ufd1
• NCBI Official Synonym Symbols: Ufd1l
• NCBI Protein Information: ubiquitin recognition factor in ER-associated degradation protein 1; ubiquitin fusion degradation protein 1 homolog
• UniProt Protein Name: Ubiquitin recognition factor in ER-associated degradation protein 1
• UniProt Gene Name: Ufd1
• UniProt Synonym Gene Names: UB fusion protein 1

Uniprot Description

Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. It may be involved in the development of some ectoderm-derived structures (). Acts as a negative regulator of type I interferon production via the complex formed with VCP and NPLOC4, which binds to DDX58/RIG-I and recruits RNF125 to promote ubiquitination and degradation of DDX58/RIG-I ().