POU domain, class 4, transcription factor 1 (Pou4f1) Recombinant Protein | Pou4f1 recombinant protein

Recombinant Mouse POU domain, class 4, transcription factor 1 (Pou4f1)

Cat. Num. AAA962332

• Gene Names: Pou4f1; Brn3; Brn-3; Brn3a; Brn3.0; Brn-3.0; E130119J07Rik
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: POU domain; class 4; transcription factor 1 (Pou4f1); Recombinant Mouse POU domain; Pou4f1 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 1-421, Full length protein
• Sequence: MMSMNSKQPHFAMHPTLPEHKYPSLHSSSEAIRRACLPTPPLQSNLFASLDETLLARAEALAAVDIAVSQGKSHPFKPDATYHTMNSVPCTSTSTVPLAHHHHHHHHHQALEPGDLLDHISSPSLALMAGAGGAGAAGGGGGAHDGPGGGGGPGGGGGPGGGGPGGGGGGGGPGGGGGGPGGGLLGGSAHPHPHMHGLGHLSHPAAAAAMNMPSGLPHPGLVAAAAHHGAAAAAAAAAAGQVAAASAAAAVVGAAGLASICDSDTDPRELEAFAERFKQRRIKLGVTQADVGSALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPILQAWLEEAEGAQREKMNKPELFNGGEKKRKRTSIAAPEKRSLEAYFAVQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKFSATY
• Sequence Length: 421

• Species: Mouse
• Preparation and Storage: Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

• NCBI GI #: 156938250
• NCBI GeneID: 18996
• NCBI Accession #: NP_035273.3
• NCBI GenBank Nucleotide #: NM_011143.4
• UniProt Accession #: P17208; E9QPT6
• Molecular Weight: 33,561 Da
• NCBI Official Full Name: POU domain, class 4, transcription factor 1
• NCBI Official Synonym Full Names: POU domain, class 4, transcription factor 1
• NCBI Official Symbol: Pou4f1
• NCBI Official Synonym Symbols: Brn3; Brn-3; Brn3a; Brn3.0; Brn-3.0; E130119J07Rik
• NCBI Protein Information: POU domain, class 4, transcription factor 1
• UniProt Protein Name: POU domain, class 4, transcription factor 1
• Protein Family: POU domain, class 4, transcription factor
• UniProt Gene Name: Pou4f1
• UniProt Synonym Gene Names: Brn-3; Brn3; Brn3a; Brain-3A; Brn-3A

Uniprot Description

Multifunctional transcription factor with different regions mediating its different effects (PubMed:10640682, PubMed:8621561, PubMed:9694219, PubMed:9722627). Acts by binding (via its C-terminal domain) to sequences related to the consensus octamer motif 5'-ATGCAAAT-3' in the regulatory regions of its target genes (PubMed:8621561, PubMed:17668438). Regulates the expression of specific genes involved in differentiation and survival within a subset of neuronal lineages. It has been shown that activation of some of these genes requires its N-terminal domain, maybe through a neuronal-specific cofactor (PubMed:12934100). Ativates BCL2 expression and protects neuronal cells from apoptosis (via the N-terminal domain) (PubMed:9722627). Induces neuronal process outgrowth and the coordinate expression of genes encoding synaptic proteins (PubMed:8972215). Exerts its major developmental effects in somatosensory neurons and in brainstem nuclei involved in motor control. Stimulates the binding affinity of the nuclear estrogene receptor ESR1 to DNA estrogen response element (ERE), and hence modulates ESR1-induced transcriptional activity (PubMed:9448000). May positively regulate POU4F2 and POU4F3 (PubMed:8876243). Regulates dorsal root ganglion sensory neuron specification and axonal projection into the spinal cord (PubMed:22326227). Plays a role in TNFSF11-mediated terminal osteoclast differentiation (PubMed:17668438). Negatively regulates its own expression interacting directly with a highly conserved autoregulatory domain surrounding the transcription initiation site (PubMed:12441296).