Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Zona pellucida sperm-binding protein 3 (Zp3) Recombinant Protein | Zp3 recombinant protein

Recombinant Mouse Zona pellucida sperm-binding protein 3 (Zp3)

Gene Names
Zp3; Zp-3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Zona pellucida sperm-binding protein 3 (Zp3); Recombinant Mouse Zona pellucida sperm-binding protein 3 (Zp3); Zona pellucida sperm-binding protein 3; Sperm receptor; Zona pellucida glycoprotein 3; Zp-3; Zona pellucida protein CCleaved into the following chain:; 1. Processed zona pellucida sperm-binding protein 3; Zp3 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-387, provide the complete extracellular domain.
Sequence
QTLWLLPGGTPTPVGSSSPVKVECLEAELVVTVSRDLFGTGKLVQPGDLTLGSEGCQPRVSVDTDVVRFNAQLHECSSRVQMTKDALVYSTFLLHDPRPVSGLSILRTNRVEVPIECRYPRQGNVSSHPIQPTWVPFRATVSSEEKLAFSLRLMEENWNTEKSAPTFHLGEVAHLQAEVQTGSHLPLQLFVDHCVATPSPLPDPNSSPYHFIVDFHGCLVDGLSESFSAFQVPRPRPETLQFTVDVFHFANSSRNTLYITCHLKVAPANQIPDKLNKACSFNKTSQSWLPVEGDADICDCCSHGNCSNSSSSQFQIHGPRQWSKLVSRNRRHVTDEADVTVGPLIFLGKANDQTVEGWTASAQTS
Sequence Length
387
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Zp3 recombinant protein
Zp3; Zp-3, Zpc

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,304 Da
NCBI Official Full Name
zona pellucida sperm-binding protein 3
NCBI Official Synonym Full Names
zona pellucida glycoprotein 3
NCBI Official Symbol
Zp3
NCBI Official Synonym Symbols
Zp-3
NCBI Protein Information
zona pellucida sperm-binding protein 3; sperm receptor; zona pellucida protein C; zona pellucida glycoprotein ZP3
UniProt Protein Name
Zona pellucida sperm-binding protein 3
UniProt Gene Name
Zp3
UniProt Synonym Gene Names
Zp-3; Zpc; Zp-3
UniProt Entry Name
ZP3_MOUSE

Uniprot Description

ZP3: The mammalian zona pellucida, which mediates species- specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation. Belongs to the ZP domain family. ZPC subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Extracellular matrix

Cellular Component: Golgi apparatus; extracellular space; endoplasmic reticulum; cell; extracellular region; integral to membrane; secretory granule; extracellular matrix; multivesicular body; proteinaceous extracellular matrix; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; intracellular

Molecular Function: acrosin binding; store-operated calcium channel activity; protein binding; signal transducer activity; manganese ion transmembrane transporter activity; carbohydrate binding

Biological Process: positive regulation of type IV hypersensitivity; phosphoinositide-mediated signaling; binding of sperm to zona pellucida; positive regulation of transcription, DNA-dependent; positive regulation of leukocyte migration; manganese ion transport; blastocyst formation; positive regulation of phosphatidylinositol biosynthetic process; positive regulation of interleukin-4 production; positive regulation of protein kinase B signaling cascade; intracellular protein transport; humoral immune response mediated by circulating immunoglobulin; positive regulation of interferon-gamma production; positive regulation of humoral immune response; positive regulation of protein kinase activity; positive regulation of T cell proliferation; negative regulation of transcription, DNA-dependent; oocyte development; positive regulation of inflammatory response

Research Articles on Zp3

Similar Products

Product Notes

The Zp3 zp3 (Catalog #AAA960677) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-387, provide the complete extracellular domain. The amino acid sequence is listed below: QTLWLLPGGT PTPVGSSSPV KVECLEAELV VTVSRDLFGT GKLVQPGDLT LGSEGCQPRV SVDTDVVRFN AQLHECSSRV QMTKDALVYS TFLLHDPRPV SGLSILRTNR VEVPIECRYP RQGNVSSHPI QPTWVPFRAT VSSEEKLAFS LRLMEENWNT EKSAPTFHLG EVAHLQAEVQ TGSHLPLQLF VDHCVATPSP LPDPNSSPYH FIVDFHGCLV DGLSESFSAF QVPRPRPETL QFTVDVFHFA NSSRNTLYIT CHLKVAPANQ IPDKLNKACS FNKTSQSWLP VEGDADICDC CSHGNCSNSS SSQFQIHGPR QWSKLVSRNR RHVTDEADVT VGPLIFLGKA NDQTVEGWTA SAQTS . It is sometimes possible for the material contained within the vial of "Zona pellucida sperm-binding protein 3 (Zp3), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.