Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Dermatopontin (DPT) Recombinant Protein | DPT recombinant protein

Recombinant Pig Dermatopontin (DPT)

Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Dermatopontin (DPT); Recombinant Pig Dermatopontin (DPT); DPT recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-183, Full length protein
Sequence
QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPHGQVVVAVRSIFNKKEGSDRQWNYACMPTPQSLGEPSECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPGHYGEEMDMISYNYDYYMRGATTTFSAVERDRQWKFIMCRMTDYDCEFANV
Sequence Length
183
Species
Sus scrofa (Pig)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for DPT recombinant protein
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
21,994 Da
NCBI Official Full Name
Dermatopontin
UniProt Protein Name
Dermatopontin
Protein Family
UniProt Gene Name
DPT
UniProt Synonym Gene Names
TRAMP

Uniprot Description

Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation (). Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation.

Similar Products

Product Notes

The DPT dpt (Catalog #AAA955753) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-183, Full length protein. The amino acid sequence is listed below: QYGDYGYPYQ QYHDYSDDGW VNLNRQGFSY QCPHGQVVVA VRSIFNKKEG SDRQWNYACM PTPQSLGEPS ECWWEEINRA GMEWYQTCSN NGLVAGFQSR YFESVLDREW QFYCCRYSKR CPYSCWMTTE YPGHYGEEMD MISYNYDYYM RGATTTFSAV ERDRQWKFIM CRMTDYDCEF ANV. It is sometimes possible for the material contained within the vial of "Dermatopontin (DPT), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.