Testing Data
(Detection limit for recombinant GST tagged DPT is 0.1ng/ml as a capture antibody.)
Mouse anti-Human DPT Monoclonal Antibody | anti-DPT antibody
DPT (Dermatopontin, Tyrosine-rich Acidic Matrix Protein, TRAMP) (HRP)
Gene Names
DPT; TRAMP
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DPT; Monoclonal Antibody; DPT (Dermatopontin; Tyrosine-rich Acidic Matrix Protein; TRAMP) (HRP); anti-DPT antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A11
Specificity
Recognizes human DPT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-DPT antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa101-201 from human DPT (NP_001928) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged DPT is 0.1ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged DPT is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-DPT antibody
DPT is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. This protein is found in various tissues and many of its tyrosine residues are sulphated. The protein is postulated to modify the behavior of TGF-beta through interaction with decorin.
Product Categories/Family for anti-DPT antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38
NCBI Official Full Name
dermatopontin
NCBI Official Synonym Full Names
dermatopontin
NCBI Official Symbol
DPT
NCBI Official Synonym Symbols
TRAMP
NCBI Protein Information
dermatopontin
UniProt Protein Name
Dermatopontin
Protein Family
UniProt Gene Name
DPT
UniProt Synonym Gene Names
TRAMP
NCBI Description
Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008]
Uniprot Description
Seems to mediate adhesion by cell surface integrin binding. May serve as a communication link between the dermal fibroblast cell surface and its extracellular matrix environment. Enhances TGFB1 activity. Inhibits cell proliferation. Accelerates collagen fibril formation, and stabilizes collagen fibrils against low-temperature dissociation ().
Research Articles on DPT
Similar Products
Product Notes
The DPT dpt (Catalog #AAA6152207) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DPT (Dermatopontin, Tyrosine-rich Acidic Matrix Protein, TRAMP) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DPT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DPT dpt for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DPT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
