Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Interferon-induced, double-stranded RNA-activated protein kinase (Eif2ak2) Recombinant Protein | Eif2ak2 recombinant protein

Recombinant Mouse Interferon-induced, double-stranded RNA-activated protein kinase (Eif2ak2)

Gene Names
Eif2ak2; Pkr; Tik; Prkr; AI467567; AI747578; 2310047A08Rik; 4732414G15Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon-induced; double-stranded RNA-activated protein kinase (Eif2ak2); Recombinant Mouse Interferon-induced; Eif2ak2 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
2-515, Full length protein
Sequence
ASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQEARNAAAKLAVDILDNENKVDCHTSASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNSELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFSGFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNSDFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHSCWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQIVTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSPEQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLKKLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC
Sequence Length
514
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,280 Da
NCBI Official Full Name
interferon-induced, double-stranded RNA-activated protein kinase
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2-alpha kinase 2
NCBI Official Symbol
Eif2ak2
NCBI Official Synonym Symbols
Pkr; Tik; Prkr; AI467567; AI747578; 2310047A08Rik; 4732414G15Rik
NCBI Protein Information
interferon-induced, double-stranded RNA-activated protein kinase
UniProt Protein Name
Interferon-induced, double-stranded RNA-activated protein kinase
UniProt Gene Name
Eif2ak2
UniProt Synonym Gene Names
Pkr; Prkr; Tik; eIF-2A protein kinase 2; PKR; Protein kinase R

Uniprot Description

IFN-induced dsRNA-dependent serine/threonine-protein kinase which plays a key role in the innate immune response to viral infection and is also involved in the regulation of signal transduction, apoptosis, cell proliferation and differentiation. Exerts its antiviral activity on a wide range of DNA and RNA viruses including west nile virus (WNV), sindbis virus (SV), foot-and-mouth virus (FMDV), semliki Forest virus (SFV) and lymphocytic choriomeningitis virus (LCMV). Inhibits viral replication via phosphorylation of the alpha subunit of eukaryotic initiation factor 2 (EIF2S1), this phosphorylation impairs the recycling of EIF2S1 between successive rounds of initiation leading to inhibition of translation which eventually results in shutdown of cellular and viral protein synthesis. Also phosphorylates other substrates including p53/TP53, PPP2R5A, DHX9, ILF3 and IRS1. In addition to serine/threonine-protein kinase activity, also has tyrosine-protein kinase activity and phosphorylates CDK1 at 'Tyr-4' upon DNA damage, facilitating its ubiquitination and proteosomal degradation. Either as an adapter protein and/or via its kinase activity, can regulate various signaling pathways (p38 MAP kinase, NF-kappa-B and insulin signaling pathways) and transcription factors (JUN, STAT1, STAT3, IRF1, ATF3) involved in the expression of genes encoding proinflammatory cytokines and IFNs. Activates the NF-kappa-B pathway via interaction with IKBKB and TRAF family of proteins and activates the p38 MAP kinase pathway via interaction with MAP2K6. Can act as both a positive and negative regulator of the insulin signaling pathway (ISP). Negatively regulates ISP by inducing the inhibitory phosphorylation of insulin receptor substrate 1 (IRS1) at 'Ser-312' and positively regulates ISP via phosphorylation of PPP2R5A which activates FOXO1, which in turn up-regulates the expression of insulin receptor substrate 2 (IRS2). Can regulate NLRP3 inflammasome assembly and the activation of NLRP3, NLRP1, AIM2 and NLRC4 inflammasomes. Can trigger apoptosis via FADD-mediated activation of CASP8. Plays a role in the regulation of the cytoskeleton by binding to gelsolin (GSN), sequestering the protein in an inactive conformation away from actin. Regulates proliferation, differentiation and survival of hematopoietic stem/progenitor cells, induction of cytokines and chemokines and plays a role in cortex-dependent memory consolidation.

Research Articles on Eif2ak2

Similar Products

Product Notes

The Eif2ak2 eif2ak2 (Catalog #AAA955421) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-515, Full length protein. The amino acid sequence is listed below: ASDTPGFYMD KLNKYRQMHG VAITYKELST SGPPHDRRFT FQVLIDEKEF PEAKGRSKQE ARNAAAKLAV DILDNENKVD CHTSASEQGL FVGNYIGLVN SFAQKKKLSV NYEQCEPNSE LPQRFICKCK IGQTMYGTGS GVTKQEAKQL AAKEAYQKLL KSPPKTAGTS SSVVTSTFSG FSSSSSMTSN GVSQSAPGSF SSENVFTNGL GENKRKSGVK VSPDDVQRNK YTLDARFNSD FEDIEEIGLG GFGQVFKAKH RIDGKRYAIK RVKYNTEKAE HEVQALAELN HVNIVQYHSC WEGVDYDPEH SMSDTSRYKT RCLFIQMEFC DKGTLEQWMR NRNQSKVDKA LILDLYEQIV TGVEYIHSKG LIHRDLKPGN IFLVDERHIK IGDFGLATAL ENDGKSRTRR TGTLQYMSPE QLFLKHYGKE VDIFALGLIL AELLHTCFTE SEKIKFFESL RKGDFSNDIF DNKEKSLLKK LLSEKPKDRP ETSEILKTLA EWRNISEKKK RNTC. It is sometimes possible for the material contained within the vial of "Interferon-induced, double-stranded RNA-activated protein kinase (Eif2ak2), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.