Bile salt sulfotransferase 1 (Sult2a1) Recombinant Protein | Sult2a1 recombinant protein
Recombinant Mouse Bile salt sulfotransferase 1 (Sult2a1)
Gene Names
Sult2a1; Std; Sth1; ST2A1; mSTa1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Bile salt sulfotransferase 1 (Sult2a1); Recombinant Mouse Bile salt sulfotransferase 1 (Sult2a1); Sult2a1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-285
, Full length protein
Sequence
MMSDYNWFEGIPFPAISYQREILEDIRNKFVVKEEDLLILTYPKSGTNWLIEIVCLIQTKGDPKWIQTVPIWNRSPWIETDIGYSALINKEGPRLITSHLPIHLFSKSFFSSKAKAIYLVRNPRDILVSGYFFWGNTNLVKNPGSLGTYFEWFLKGNVLFGSWFEHVRGWLSMREWDNFLVLYYEDIKKDTKGTIKKICDFLGKNLGPDELDLVLKYSSFQAMKENNMSNFSLIKEDQVTNGLKLMRKGTIGDWKNHFTVAQAEAFDKVFQEKMAGFPPGIFPWE
Sequence Length
285
Species
Mouse
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
Related Product Information for Sult2a1 recombinant protein
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene is primarily expressed in liver and adrenal tissues where the encoded protein sulfates steroids and bile acids.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,213 Da
NCBI Official Full Name
bile salt sulfotransferase 1
NCBI Official Synonym Full Names
sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
NCBI Official Symbol
Sult2a1
NCBI Official Synonym Symbols
Std; Sth1; ST2A1; mSTa1
NCBI Protein Information
bile salt sulfotransferase 1
UniProt Protein Name
Bile salt sulfotransferase 1
Protein Family
UniProt Gene Name
Sult2a1
UniProt Synonym Gene Names
Sta1; ST; ST2A1
NCBI Description
This is one of seven sulfotransferase family 2A genes in a chromosome 7 A1 cluster. [provided by RefSeq, May 2010]
Uniprot Description
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze sulfonation of hydroxysteroids and xenobiotics.
Research Articles on Sult2a1
Similar Products
Product Notes
The Sult2a1 sult2a1 (Catalog #AAA953141) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-285 , Full length protein. The amino acid sequence is listed below: MMSDYNWFEG IPFPAISYQR EILEDIRNKF VVKEEDLLIL TYPKSGTNWL IEIVCLIQTK GDPKWIQTVP IWNRSPWIET DIGYSALINK EGPRLITSHL PIHLFSKSFF SSKAKAIYLV RNPRDILVSG YFFWGNTNLV KNPGSLGTYF EWFLKGNVLF GSWFEHVRGW LSMREWDNFL VLYYEDIKKD TKGTIKKICD FLGKNLGPDE LDLVLKYSSF QAMKENNMSN FSLIKEDQVT NGLKLMRKGT IGDWKNHFTV AQAEAFDKVF QEKMAGFPPG IFPWE. It is sometimes possible for the material contained within the vial of "Bile salt sulfotransferase 1 (Sult2a1), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
