Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Heterogeneous nuclear ribonucleoprotein A1 Recombinant Protein | ROA1 recombinant protein

Recombinant Human Heterogeneous nuclear ribonucleoprotein A1

Gene Names
HNRNPA1; UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
Reactivity
Human
Purity
Greater than 90% as determined by SDS-PAGE.
Synonyms
Heterogeneous nuclear ribonucleoprotein A1; Recombinant Human Heterogeneous nuclear ribonucleoprotein A1; Helix-destabilizing protein; Single-strand RNA-binding proteinhnRNP core protein A1; ROA1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Reactivity
Human
Purity/Purification
Greater than 90% as determined by SDS-PAGE.
Form/Format
20mM Tris-HCl based buffer, pH8.0
Sequence Positions
Partial of the Full Length of 2-372aa, 2-354aa
Sequence
SKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHNCEVRKALSKQEMASASSSQRGRSGSGNFGGGRGGGFGGNDNFGRGGNFSGRGGFGGSRGGGGYGGSGDGYNGFGNDGGYGGGGPGYSGGSRGYGSGGQGYGNQGSGYGGSGSYDSYNNGGGGGFGGGSGSNFGGGGSYNDFGNYNNQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQG
Target
ROA1
Tag Info
His-tag
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C. Repeated freezing and thawing is not recommended. Store working aliquots at 4 degree C for up to one week.
Related Product Information for ROA1 recombinant protein
Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly (A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication.
Recombinant Protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kD
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein A1 isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein A1
NCBI Official Symbol
HNRNPA1
NCBI Official Synonym Symbols
UP 1; ALS19; ALS20; HNRPA1; IBMPFD3; HNRPA1L3; hnRNP A1; hnRNP-A1
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein A1
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein A1
UniProt Gene Name
HNRNPA1
UniProt Synonym Gene Names
HNRPA1; hnRNP A1

NCBI Description

This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome. [provided by RefSeq, Feb 2016]

Uniprot Description

hnRNP A1: Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly(A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication. Identified in the spliceosome C complex. Identified in a mRNP granule complex, at least composed of ACTB, ACTN4, DHX9, ERG, HNRNPA1, HNRNPA2B1, HNRNPAB, HNRNPD, HNRNPL, HNRNPR, HNRNPU, HSPA1, HSPA8, IGF2BP1, ILF2, ILF3, NCBP1, NCL, PABPC1, PABPC4, PABPN1, RPLP0, RPS3, RPS3A, RPS4X, RPS8, RPS9, SYNCRIP, TROVE2, YBX1 and untranslated mRNAs. Interacts with SEPT6. Interacts with HCV NS5B and with the 5'-UTR and 3'-UTR of HCV RNA. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; RNA splicing; RNA-binding; Spliceosome

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: cytoplasm; membrane; nucleoplasm; nucleus; ribonucleoprotein complex; spliceosome

Molecular Function: protein binding; protein domain specific binding; RNA binding; single-stranded DNA binding; single-stranded RNA binding

Biological Process: cellular response to glucose starvation; fibroblast growth factor receptor signaling pathway; mRNA processing; negative regulation of telomere maintenance via telomerase; nuclear export; nuclear import; nuclear mRNA splicing, via spliceosome; positive regulation of telomere maintenance via telomerase; regulation of alternative nuclear mRNA splicing, via spliceosome; RNA export from nucleus; RNA metabolic process

Disease: Amyotrophic Lateral Sclerosis 20; Inclusion Body Myopathy With Early-onset Paget Disease With Or Without Frontotemporal Dementia 3

Research Articles on ROA1

Similar Products

Product Notes

The ROA1 hnrnpa1 (Catalog #AAA9420321) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is Partial of the Full Length of 2-372aa, 2-354aa. The Recombinant Human Heterogeneous nuclear ribonucleoprotein A1 reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: SKSESPKEPE QLRKLFIGGL SFETTDESLR SHFEQWGTLT DCVVMRDPNT KRSRGFGFVT YATVEEVDAA MNARPHKVDG RVVEPKRAVS REDSQRPGAH LTVKKIFVGG IKEDTEEHHL RDYFEQYGKI EVIEIMTDRG SGKKRGFAFV TFDDHDSVDK IVIQKYHTVN GHNCEVRKAL SKQEMASASS SQRGRSGSGN FGGGRGGGFG GNDNFGRGGN FSGRGGFGGS RGGGGYGGSG DGYNGFGNDG GYGGGGPGYS GGSRGYGSGG QGYGNQGSGY GGSGSYDSYN NGGGGGFGGG SGSNFGGGGS YNDFGNYNNQ SSNFGPMKGG NFGGRSSGPY GGGGQYFAKP RNQG. It is sometimes possible for the material contained within the vial of "Heterogeneous nuclear ribonucleoprotein A1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.