Rabbit HNRNPD Polyclonal Antibody | anti-HNRNPD antibody

HNRNPD Polyclonal Antibody

Cat. Num. AAA9140420

• Gene Names: HNRNPD; P37; AUF1; AUF1A; HNRPD; hnRNPD0
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purification
• Synonyms: HNRNPD; Polyclonal Antibody; HNRNPD Polyclonal Antibody; AUF1; AUF1A; HNRPD; P37; hnRNPD0; heterogeneous nuclear ribonucleoprotein D; anti-HNRNPD antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Concentration: 1.75 mg/ml (varies by lot)
• Sequence Length: 287

• Applicable Applications for anti-HNRNPD antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: WB: 1:500-1:2000; IHC: 1:50-1:200; IF: 1:50-1:200
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human HNRNPD (NP_002129.2).
• Immunogen Sequence: MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVSRRGGHQNSYKPY
• Positive Samples: HeLa, Jurkat, HepG2, Mouse Brain, Rat Brain
• Cellular Location: Cytoplasm, Nucleus
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-HNRNPD Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-HNRNPD Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-HNRNPD Polyclonal Antibody)

Immunohistochemistry (IHC)

(Immunohistochemistry-HNRNPD Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-HNRNPD Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-HNRNPD Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-HNRNPD Polyclonal Antibody)

Immunofluorescence (IF)

(Immunofluorescence-HNRNPD Polyclonal Antibody)

Related Product Information for anti-HNRNPD antibody

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.

NCBI and Uniprot Product Information

• NCBI GI #: 51477708
• NCBI GeneID: 3184
• NCBI Accession #: NP_001003810.1
• NCBI GenBank Nucleotide #: NP_001003810.1
• UniProt Accession #: Q14103
• Molecular Weight: Calculated: 30kDa; 32kDa; 36kDa; 38kDa; Observed: 37-45kDa
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein D0 isoform d
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein D
• NCBI Official Symbol: HNRNPD
• NCBI Official Synonym Symbols: P37; AUF1; AUF1A; HNRPD; hnRNPD0
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein D0
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein D0
• Protein Family: Heterogeneous nuclear ribonucleoprotein
• UniProt Gene Name: HNRNPD
• UniProt Synonym Gene Names: AUF1; HNRPD; hnRNP D0
• UniProt Entry Name: HNRPD_HUMAN

NCBI Description

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

hnRNP D0: a ubiquitously expressed heterogeneous nuclear ribonucleoprotein (hnRNP). Implicated in the regulation of mRNA stability. Has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. Four alternatively spliced transcript variants have been described.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; RNA binding; telomeric DNA binding; nucleotide binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; positive regulation of translation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; RNA splicing; RNA catabolic process; gene expression; regulation of mRNA stability; regulation of circadian rhythm