Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HNRNPD expression in transfected 293T cell line by HNRNPD polyclonal antibody. Lane 1: HNRPD transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human HNRNPD Polyclonal Antibody | anti-HNRNPD antibody

HNRNPD (AUF1, HNRPD, Heterogeneous Nuclear Ribonucleoprotein D0, hnRNP D0, AU-rich Element RNA-binding Protein 1) (PE)

Gene Names
HNRNPD; P37; AUF1; AUF1A; HNRPD; hnRNPD0
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HNRNPD; Polyclonal Antibody; HNRNPD (AUF1; HNRPD; Heterogeneous Nuclear Ribonucleoprotein D0; hnRNP D0; AU-rich Element RNA-binding Protein 1) (PE); anti-HNRNPD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human HNRNPD.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HNRNPD antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human HNRNPD, aa1-355 (NP_112738.1).
Immunogen Sequence
MSEEQFGGDGAAAAATAAVGGSAGEQEGAMVAATQGAAAAAGSGAGTGGGTASGGTEGGSAESEGAKIDASKNEEDEGHSNSSPRHSEAATAQREEWKMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRAKAMKTKEPVKKIFVGGLSPDTPEEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGNYGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKPY
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HNRNPD expression in transfected 293T cell line by HNRNPD polyclonal antibody. Lane 1: HNRPD transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HNRNPD expression in transfected 293T cell line by HNRNPD polyclonal antibody. Lane 1: HNRPD transfected lysate (38.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-HNRNPD antibody
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.
Product Categories/Family for anti-HNRNPD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,672 Da
NCBI Official Full Name
heterogeneous nuclear ribonucleoprotein D0 isoform a
NCBI Official Synonym Full Names
heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37kDa)
NCBI Official Symbol
HNRNPD
NCBI Official Synonym Symbols
P37; AUF1; AUF1A; HNRPD; hnRNPD0
NCBI Protein Information
heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; ARE-binding protein AUFI, type A
UniProt Protein Name
Heterogeneous nuclear ribonucleoprotein D0
UniProt Gene Name
HNRNPD
UniProt Synonym Gene Names
AUF1; HNRPD; hnRNP D0
UniProt Entry Name
HNRPD_HUMAN

Uniprot Description

hnRNP D0: a ubiquitously expressed heterogeneous nuclear ribonucleoprotein (hnRNP). Implicated in the regulation of mRNA stability. Has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. Four alternatively spliced transcript variants have been described.

Protein type: RNA splicing; RNA-binding

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: nucleoplasm; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; RNA binding; telomeric DNA binding; nucleotide binding

Biological Process: RNA processing; nuclear mRNA splicing, via spliceosome; positive regulation of translation; transcription, DNA-dependent; regulation of transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; RNA splicing; RNA catabolic process; gene expression; regulation of mRNA stability; regulation of circadian rhythm

Similar Products

Product Notes

The HNRNPD hnrnpd (Catalog #AAA6381451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HNRNPD (AUF1, HNRPD, Heterogeneous Nuclear Ribonucleoprotein D0, hnRNP D0, AU-rich Element RNA-binding Protein 1) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HNRNPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HNRNPD hnrnpd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNRNPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.