Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Mouse IL-18/IL-1F4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

IL-18/IL-1F4 Recombinant Protein | IL-18 recombinant protein

Recombinant Mouse IL-18/IL-1F4 Protein

Gene Names
Il18; Igif; Il-18
Purity
>95% by SDS-PAGE.
Synonyms
IL-18/IL-1F4; Recombinant Mouse IL-18/IL-1F4 Protein; Interleukin-18; Il18; Interferon gamma-inducing factor; IFN-gamma-inducing factor; Interleukin-1gamma; IL-1 gamma; Igif; IL-18 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Sequence
NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Sequence Length
192
Species
Mouse
Endotoxin
< 1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the N-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Mouse IL-18/IL-1F4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

SDS-Page (Recombinant Mouse IL-18/IL-1F4 Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)
Related Product Information for IL-18 recombinant protein
Description: Recombinant Mouse IL-18/IL-1F4 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Asn36-Ser192) of mouse IL-18/IL-1F4 (Accession #P70380) fused with an initial Met at the N-terminus and a 6xHis tag at the N-terminus.

Background: Interleukin-18 (IL-18) is a protein which belongs to the IL-1 family. It is expressed as a 24 kDa precursor byendothelial and epithelial cells, keratinocytes, gamma delta T cells, and phagocytes. Mature mouse IL-18 shares63% and 91% amino acid sequence identity with mouse and rat IL-18, respectively. IL-18 binds to the widelyexpressed IL-18 R alpha which recruits IL-18 R beta to form the signaling receptor complex. Its bioactivity isnegatively regulated by interactions with IL-18 binding proteins and virally encoded IL-18BP homologs. Itaugments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helpertype I cells. In the presence of IL-12 or IL-15, IL-18 enhances anti-viral Th1 immune responses by inducing IFN-gamma production and the cytolytic activity of CD8+ T cells and NK cells. In the absence of IL-12 or IL-15,however, IL-18 promotes production of the Th2 cytokines IL-4 and IL-13 by CD4+ T cells and basophils.
Product Categories/Family for IL-18 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-18 isoform a
NCBI Official Synonym Full Names
interleukin 18
NCBI Official Symbol
Il18
NCBI Official Synonym Symbols
Igif; Il-18
NCBI Protein Information
interleukin-18
UniProt Protein Name
Interleukin-18
UniProt Gene Name
Il18
UniProt Synonym Gene Names
Igif; IL-18; IFN-gamma-inducing factor; IL-1 gamma
UniProt Entry Name
IL18_MOUSE

Uniprot Description

IL18: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells. Belongs to the IL-1 family.

Protein type: Cytokine

Cellular Component: apical plasma membrane; cytoplasm; extracellular space

Molecular Function: cytokine activity

Biological Process: activation of protein kinase B; angiogenesis; cholesterol homeostasis; detection of mechanical stimulus involved in sensory perception of pain; immune response; induction of apoptosis via death domain receptors; inflammatory response; interferon-gamma biosynthetic process; interleukin-13 biosynthetic process; lipopolysaccharide-mediated signaling pathway; MAPKKK cascade; natural killer cell activation; negative regulation of myoblast differentiation; negative regulation of neutrophil apoptosis; negative regulation of peptidyl-tyrosine phosphorylation; positive regulation of activated T cell proliferation; positive regulation of apoptosis; positive regulation of chemokine production; positive regulation of collagen biosynthetic process; positive regulation of granulocyte macrophage colony-stimulating factor production; positive regulation of interferon-gamma production; positive regulation of interleukin-17 production; positive regulation of interleukin-8 production; positive regulation of natural killer cell proliferation; positive regulation of neuron apoptosis; positive regulation of NF-kappaB import into nucleus; positive regulation of NK T cell proliferation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein kinase B signaling cascade; positive regulation of smooth muscle cell migration; positive regulation of smooth muscle cell proliferation; positive regulation of superoxide release; positive regulation of T-helper 2 cell differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of tumor necrosis factor production; positive regulation of tyrosine phosphorylation of Stat3 protein; positive regulation of vascular permeability; regulation of cell adhesion; response to hypoxia; sleep; T-helper 1 type immune response

Research Articles on IL-18

Similar Products

Product Notes

The IL-18 il18 (Catalog #AAA9140094) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: NFGRLHCTTA VIRNINDQVL FVDKRQPVFE DMTDIDQSAS EPQTRLIIYM YKDSEVRGLA VTLSVKDSKM STLSCKNKII SFEEMDPPEN IDDIQSDLIF FQKRVPGHNK MEFESSLYEG HFLACQKEDD AFKLILKKKD ENGDKSVMFT LTNLHQS. It is sometimes possible for the material contained within the vial of "IL-18/IL-1F4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.