VEGF-D recombinant protein

Recombinant Human VEGF-D Protein

Cat. Num. AAA9139962

• Gene Names: VEGFD; FIGF; VEGF-D
• Purity: >95% by SDS-PAGE.
• Synonyms: VEGF-D; Recombinant Human VEGF-D Protein; Vascular Endothelial Growth Factor D; c-Fos-Induced Growth Factor; FIGF; VEGFD; VEGF-D recombinant protein

• Host: Human Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
• Sequence: FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS
• Sequence Length: 354

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human VEGF-D Protein was determined by SDS-PAGE under reducing conditions with Coomassie Blue.)

Related Product Information for VEGF-D recombinant protein

Description: Recombinant Human VEGF-D Protein is produced by Human cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D (Accession #O43915) fused with a 6xHis tag at the C-terminus.

Background: Vascular endothelial growth factor D (VEGF-D) is a member of the platelet-derived growth factor/vascularendothelial growth factor (PDGF/VEGF) family. It is highly expressed in lung, heart, small intestine and fetallung, and at lower levels in skeletal muscle, colon, and pancreas. VEGF-D is growth factor active inangiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration andalso has effects on the permeability of blood vessels. It may function in the formation of the venous andlymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphaticendothelium in adults. It undergoes a complex proteolytic maturation, generating multiple processed formsthat bind and activate VEGFR-2 and VEGFR-3 receptors.

Product Categories/Family for VEGF-D recombinant protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 4758378
• NCBI GeneID: 2277
• NCBI Accession #: NP_004460.1
• NCBI GenBank Nucleotide #: NP_004460.1
• UniProt Accession #: O43915
• NCBI Official Full Name: vascular endothelial growth factor D preproprotein
• NCBI Official Synonym Full Names: vascular endothelial growth factor D
• NCBI Official Symbol: VEGFD
• NCBI Official Synonym Symbols: FIGF; VEGF-D
• NCBI Protein Information: vascular endothelial growth factor D
• UniProt Protein Name: Vascular endothelial growth factor D
• UniProt Gene Name: FIGF
• UniProt Synonym Gene Names: VEGFD; VEGF-D; FIGF
• UniProt Entry Name: VEGFD_HUMAN

NCBI Description

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]

Uniprot Description

VEGFD: Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Belongs to the PDGF/VEGF growth factor family.

Protein type: Cytokine; Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: Xp22.31

Cellular Component: extracellular space; membrane; extracellular region

Molecular Function: protein homodimerization activity; growth factor activity; platelet-derived growth factor receptor binding; vascular endothelial growth factor receptor 3 binding; vascular endothelial growth factor receptor binding; chemoattractant activity

Biological Process: cell proliferation; platelet activation; platelet degranulation; positive chemotaxis; positive regulation of cell division; positive regulation of cell proliferation; angiogenesis; blood coagulation; vascular endothelial growth factor receptor signaling pathway; cell differentiation; induction of positive chemotaxis