Vitamin D-binding protein Recombinant Protein | VDBP recombinant protein

Recombinant Human Vitamin D-binding protein

• Gene Names: FIGF; VEGFD; VEGF-D
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vitamin D-binding protein; Recombinant Human Vitamin D-binding protein; c-Fos-induced growth factor; FIGF; VDBP recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 19-474
• Sequence: RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDC
• Sequence Length: 354

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

Related Product Information for VDBP recombinant protein

Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.

Product Categories/Family for VDBP recombinant protein

Cancer

References

Molecular cloning of a novel vascular endothelial growth factor, VEGF-D.Yamada Y., Nezu J., Shimane M., Hirata Y.Genomics 42:483-488(1997) Human FIGF cloning, gene structure, and mapping to chromosome Xp22.1 between the PIGA and the GRPR genes.Rocchigiani M., Lestingi M., Luddi A., Orlandini M., Franco B., Rossi E., Ballabio A., Zuffardi O., Oliviero S.Genomics 47:207-216(1998) Vascular endothelial growth factor D (VEGF-D) is a ligand for the tyrosine kinases VEGF receptor 2 (Flk1) and VEGF receptor 3 (Flt4) .Achen M.G., Jeltsch M., Kukk E., Maekinen T., Vitali A., Wilks A.F., Alitalo K., Stacker S.A.Proc. Natl. Acad. Sci. U.S.A. 95:548-553(1998) Complete sequencing and characterization of 21,243 full-length human cDNAs.Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S., Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.Nat. Genet. 36:40-45(2004)

NCBI and Uniprot Product Information

• NCBI GI #: 4758378
• NCBI GeneID: 2277
• NCBI Accession #: NP_004460.1
• NCBI GenBank Nucleotide #: NM_004469.4
• UniProt Accession #: O43915; B2R7Z3
• Molecular Weight: 55kD
• NCBI Official Full Name: vascular endothelial growth factor D preproprotein
• NCBI Official Synonym Full Names: c-fos induced growth factor (vascular endothelial growth factor D)
• NCBI Official Symbol: FIGF
• NCBI Official Synonym Symbols: VEGFD; VEGF-D
• NCBI Protein Information: vascular endothelial growth factor D
• UniProt Protein Name: Vascular endothelial growth factor D
• Protein Family: Vitamin D-binding protein
• UniProt Gene Name: FIGF
• UniProt Synonym Gene Names: VEGFD; VEGF-D; FIGF
• UniProt Entry Name: VEGFD_HUMAN

NCBI Description

The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family and is active in angiogenesis, lymphangiogenesis, and endothelial cell growth. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-2 and VEGFR-3 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor C. Read-through transcription has been observed between this locus and the upstream PIR (GeneID 8544) locus. [provided by RefSeq, Feb 2011]

Uniprot Description

VEGFD: Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Belongs to the PDGF/VEGF growth factor family.

Protein type: Motility/polarity/chemotaxis; Secreted, signal peptide; Secreted; Cytokine

Chromosomal Location of Human Ortholog: Xp22.31

Cellular Component: extracellular region; extracellular space; membrane

Molecular Function: chemoattractant activity; growth factor activity; platelet-derived growth factor receptor binding; protein homodimerization activity; vascular endothelial growth factor receptor 3 binding; vascular endothelial growth factor receptor binding

Biological Process: angiogenesis; blood coagulation; cell differentiation; cell proliferation; induction of positive chemotaxis; platelet activation; platelet degranulation; positive chemotaxis; positive regulation of cell division; positive regulation of cell proliferation; positive regulation of interleukin-6 production; regulation of vascular endothelial growth factor receptor signaling pathway; response to hypoxia; vascular endothelial growth factor receptor signaling pathway