IL6 active protein

Recombinant Human IL6 Protein

Cat. Num. AAA9139607

• Gene Names: IL6; CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
• Purity: >95% by SDS-PAGE.
• Synonyms: IL6; Recombinant Human IL6 Protein; BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6; IL6 active protein

• Host: E Coli
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
• Sequence: PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
• Sequence Length: 212

• Species: Human
• Endotoxin: < 0.1 EU/ug of the protein by LAL method.
• Biological Activity: Measured in a cell proliferation assay using TF?1 human erythroleukemic cells.The ED50 for this effect is 2-4 ng/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL6 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 21 kDa.)

Related Product Information for IL6 active protein

Description: Recombinant Human IL6 Protein is produced by E. coli expression system. The target protein is expressed with sequence (Pro29-Met212) of human IL6 (Accession #NP_000591.1) fused with an initial Met at the N-terminus and a 6xHis tag at the C-terminus.

Background: Interleukin-6 (IL-6) is a multifunctional alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.

Product Categories/Family for IL6 active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 124347
• NCBI GeneID: 3569
• UniProt Accession #: P05231
• NCBI Official Full Name: Interleukin-6
• NCBI Official Synonym Full Names: interleukin 6
• NCBI Official Symbol: IL6
• NCBI Official Synonym Symbols: CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
• NCBI Protein Information: interleukin-6
• UniProt Protein Name: Interleukin-6
• Protein Family: Interleukin
• UniProt Gene Name: IL6
• UniProt Synonym Gene Names: IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
• UniProt Entry Name: IL6_HUMAN

NCBI Description

This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]