SDS-Page
(Recombinant Human IL6 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23-30kDa.)
IL6 active protein
Recombinant Human IL6 Protein
Gene Names
IL6; CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
Purity
>90% by SDS-PAGE.
Synonyms
IL6; Recombinant Human IL6 Protein; BSF-2; BSF2; CDF; HGF; HSF; IFN-beta-2; IFNB2; IL-6; IL6 active protein
Host
HEK293
Purity/Purification
>90% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Sequence Length
212
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured in a cell proliferation assay using TF?1 human erythroleukemic cells.The ED50 for this effect is 2-4ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.
SDS-Page
(Recombinant Human IL6 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23-30kDa.)
SDS-Page
(Recombinant Human IL6 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23-30kDa.)
Related Product Information for IL6 active protein
Description: Recombinant Human IL6 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Val30-Met212) of human IL6 (Accession #NP_000591.1) fused with a 6xHis tag at the C-terminus.
Background: Interleukin-6 (IL-6) is a multifunctional alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Background: Interleukin-6 (IL-6) is a multifunctional alpha-helical cytokine that regulates cell growth and differentiation of various tissues, which is known particularly for its role in the immune response and acute phase reactions. The encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this protein is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis.
Product Categories/Family for IL6 active protein
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Interleukin-6
NCBI Official Synonym Full Names
interleukin 6
NCBI Official Symbol
IL6
NCBI Official Synonym Symbols
CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2
NCBI Protein Information
interleukin-6
UniProt Protein Name
Interleukin-6
Protein Family
UniProt Gene Name
IL6
UniProt Synonym Gene Names
IFNB2; IL-6; BSF-2; CDF; IFN-beta-2
UniProt Entry Name
IL6_HUMAN
NCBI Description
This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Research Articles on IL6
Similar Products
Product Notes
The IL6 il6 (Catalog #AAA9141745) is an Active Protein produced from HEK293 and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: VPPGEDSKDV AAPHRQPLTS SERIDKQIRY ILDGISALRK ETCNKSNMCE SSKEALAENN LNLPKMAEKD GCFQSGFNEE TCLVKIITGL LEFEVYLEYL QNRFESSEEQ ARAVQMSTKV LIQFLQKKAK NLDAITTPDP TTNASLLTKL QAQNQWLQDM TTHLILRSFK EFLQSSLRAL RQM. It is sometimes possible for the material contained within the vial of "IL6, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
