Rabbit anti-Human WDR36 Polyclonal Antibody | anti-WDR36 antibody
WDR36 Polyclonal Antibody
Gene Names
WDR36; GLC1G; UTP21; TAWDRP; TA-WDRP
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
WDR36; Polyclonal Antibody; WDR36 Polyclonal Antibody; GLC1G; TA-WDRP; TAWDRP; UTP21; anti-WDR36 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LRPLPADYVPSIVMLPGTCQTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
Sequence Length
951
Applicable Applications for anti-WDR36 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human WDR36
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus, nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-WDR36 antibody
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Mutations in this gene have been associated with adult-onset primary open-angle glaucoma (POAG).
Product Categories/Family for anti-WDR36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
105kDa
NCBI Official Full Name
WD repeat-containing protein 36
NCBI Official Synonym Full Names
WD repeat domain 36
NCBI Official Symbol
WDR36
NCBI Official Synonym Symbols
GLC1G; UTP21; TAWDRP; TA-WDRP
NCBI Protein Information
WD repeat-containing protein 36
UniProt Protein Name
WD repeat-containing protein 36
Protein Family
UniProt Gene Name
WDR36
UniProt Synonym Gene Names
TA-WDRP
NCBI Description
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Mutations in this gene have been associated with adult-onset primary open-angle glaucoma (POAG). [provided by RefSeq, Jul 2008]
Uniprot Description
Involved in the nucleolar processing of SSU 18S rRNA. Involved in T-cell activation and highly coregulated with IL2.
Research Articles on WDR36
Similar Products
Product Notes
The WDR36 wdr36 (Catalog #AAA9135552) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The WDR36 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's WDR36 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the WDR36 wdr36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LRPLPADYVP SIVMLPGTCQ TQDVEVSEET VEPSDELIEY DSPEQLNEQL VTLSLLPESR WKNLLNLDVI KKKNKPKEPP KVPKSAPFFI PTIPGLVPRY AAPEQNNDPQ QSKVVNLGVL AQKSDFCLKL EEGLVNNKYD TALNLLKESG PSGIETELRS LSPDCGGSIE VMQSFLKMIG MMLDRKRDFE LAQAYLALFL KLHLKMLPSE PVLLEEITNL SSQVEENWTH LQSLFNQSMC ILNYLKSALL. It is sometimes possible for the material contained within the vial of "WDR36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
