Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SAA4 rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.)

Rabbit anti-Human SAA4 Polyclonal Antibody | anti-SAA4 antibody

SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) APC

Gene Names
SAA4; CSAA; C-SAA
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SAA4; Polyclonal Antibody; SAA4 (CSAA; Serum Amyloid A-4 Protein; Constitutively Expressed Serum Amyloid A Protein; C-SAA) APC; anti-SAA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SAA4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-SAA4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SAA4, aa1-130 (NP_006503.1).
Immunogen Sequence
MRLFTGIVFCSLVMGVTSESWRSFFKEALQGVGDMGRAYWDIMISNHQNSNRYLYARGNYDAAQRGPGGVWAAKLISRSRVYLQGLIDYYLFGNSSTVLEDSKSNEKAEEWGRSGKDPDRFRPDGLPKKY
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(SAA4 rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.)

Western Blot (WB) (SAA4 rabbit polyclonal antibody. Western Blot analysis of SAA4 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of SAA4 expression in transfected 293T cell line by SAA4 polyclonal antibody. Lane 1: SAA4 transfected lysate (14.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SAA4 expression in transfected 293T cell line by SAA4 polyclonal antibody. Lane 1: SAA4 transfected lysate (14.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-SAA4 antibody
SAA4 is a constitutively expressed protein belonging to the SAA family. It is a major acute phase reactant and an apolipoprotein of the HDL complex. SAA4 is constitutively expressed only in humans and mice, is associated almost entirely with lipoproteins of the high density range. Its physiological function is unknown and its serum concentration has no relationship with those of other major apolipoproteins. The presence of SAA4 mRNA and protein in macrophage derived foam cells of coronary and carotid arteries suggested a specific role of human SAA4 during inflammation including atherosclerosis.
Product Categories/Family for anti-SAA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,747 Da
NCBI Official Full Name
serum amyloid A-4 protein
NCBI Official Synonym Full Names
serum amyloid A4, constitutive
NCBI Official Symbol
SAA4
NCBI Official Synonym Symbols
CSAA; C-SAA
NCBI Protein Information
serum amyloid A-4 protein; constitutively expressed serum amyloid A protein
UniProt Protein Name
Serum amyloid A-4 protein
Protein Family
UniProt Gene Name
SAA4
UniProt Synonym Gene Names
CSAA; C-SAA
UniProt Entry Name
SAA4_HUMAN

Uniprot Description

SAA4: Major acute phase reactant. Apolipoprotein of the HDL complex. Belongs to the SAA family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p15.1-p14

Cellular Component: extracellular region

Biological Process: acute-phase response

Research Articles on SAA4

Similar Products

Product Notes

The SAA4 saa4 (Catalog #AAA6393223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SAA4 (CSAA, Serum Amyloid A-4 Protein, Constitutively Expressed Serum Amyloid A Protein, C-SAA) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAA4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAA4 saa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SAA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.