Rabbit RBM8A Polyclonal Antibody | anti-RBM8A antibody

RBM8A Polyclonal Antibody

Cat. Num. AAA9135111

• Gene Names: RBM8A; TAR; Y14; RBM8; ZNRP; RBM8B; ZRNP1; BOV-1A; BOV-1B; BOV-1C; MDS014; DEL1q21.1; C1DELq21.1
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: RBM8A; Polyclonal Antibody; RBM8A Polyclonal Antibody; BOV-1A; BOV-1B; BOV-1C; C1DELq21.1; DEL1q21.1; MDS014; RBM8; RBM8B; TAR; Y14; ZNRP; ZRNP1; anti-RBM8A antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGV
• Sequence Length: 174

• Applicable Applications for anti-RBM8A antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human RBM8A
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cytoplasm, Nucleus, Nucleus speckle
• Positive Samples: U251, HT-29, HepG2, HeLa, 293T, mouse brain, mouse heart, mouse kidney, rat liver
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using RBM8A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Related Product Information for anti-RBM8A antibody

This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome.

Product Categories/Family for anti-RBM8A antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 4826972
• NCBI GeneID: 9939
• NCBI Accession #: NP_005096.1
• NCBI GenBank Nucleotide #: NM_005105.4
• UniProt Accession #: Q9Y5S9; Q6FHD1; Q6IQ40; Q9GZX8; Q9NZI4; B3KQI9
• Molecular Weight: Calculated: 19kDa; Observed: 20kDa
• NCBI Official Full Name: RNA-binding protein 8A
• NCBI Official Synonym Full Names: RNA binding motif protein 8A
• NCBI Official Symbol: RBM8A
• NCBI Official Synonym Symbols: TAR; Y14; RBM8; ZNRP; RBM8B; ZRNP1; BOV-1A; BOV-1B; BOV-1C; MDS014; DEL1q21.1; C1DELq21.1
• NCBI Protein Information: RNA-binding protein 8A
• UniProt Protein Name: RNA-binding protein 8A
• Protein Family: RNA-binding protein
• UniProt Gene Name: RBM8A
• UniProt Synonym Gene Names: RBM8; BOV-1

NCBI Description

This gene encodes a protein with a conserved RNA-binding motif. The protein is found predominantly in the nucleus, although it is also present in the cytoplasm. It is preferentially associated with mRNAs produced by splicing, including both nuclear mRNAs and newly exported cytoplasmic mRNAs. It is thought that the protein remains associated with spliced mRNAs as a tag to indicate where introns had been present, thus coupling pre- and post-mRNA splicing events. Previously, it was thought that two genes encode this protein, RBM8A and RBM8B; it is now thought that the RBM8B locus is a pseudogene. There are two alternate translation start codons with this gene, which result in two forms of the protein. An allele mutation and a low-frequency noncoding single-nucleotide polymorphism (SNP) in this gene cause thrombocytopenia-absent radius (TAR) syndrome. [provided by RefSeq, Jul 2013]

Uniprot Description

Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Its removal from cytoplasmic mRNAs requires translation initiation from EJC-bearing spliced mRNAs. Associates preferentially with mRNAs produced by splicing. Does not interact with pre-mRNAs, introns, or mRNAs produced from intronless cDNAs. Associates with both nuclear mRNAs and newly exported cytoplasmic mRNAs. The MAGOH-RBM8A heterodimer is a component of the nonsense mediated decay (NMD) pathway. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms such as Bcl-X(S); the function is different from the established EJC assembly.