Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against immunogen (36.63kD).)

Mouse anti-Human FGG Monoclonal Antibody | anti-FGG antibody

FGG (Fibrinogen gamma chain, PRO2061, FGG) (FITC)

Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGG; Monoclonal Antibody; FGG (Fibrinogen gamma chain; PRO2061; FGG) (FITC); anti-FGG antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F2
Specificity
Recognizes human FGG.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FGG antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa31-130 from human FGG (AAH07044) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAIQLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against immunogen (36.63kD).)

Western Blot (WB)

(Western Blot analysis of FGG expression in Hela NE using 126795.)

Western Blot (WB) (Western Blot analysis of FGG expression in Hela NE using 126795.)

Immunohistochemistry (IHC)

(Immunoperoxidase to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue using 126795 (1ug/ml).)

Immunohistochemistry (IHC) (Immunoperoxidase to FGG on formalin-fixed paraffin-embedded human hepatocellular carcinoma tissue using 126795 (1ug/ml).)

Testing Data

(Detection limit for 126795 ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for 126795 ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between ICAM1 and FGG. HeLa cells were stained with ICAM1 rabbit purified polyclonal (1:1200) and 126795 (1:50). Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between ICAM1 and FGG. HeLa cells were stained with ICAM1 rabbit purified polyclonal (1:1200) and 126795 (1:50). Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex)
Product Categories/Family for anti-FGG antibody
References
1. Identification of Novel Diagnostic Biomarkers for Asthma and Chronic Obstructive Pulmonary Disease. Verrills NM, Irwin JA, He XY, Wood LG, Powell H, Simpson JL, McDonald VM, Sim A, Gibson PG.Am J Respir Crit Care Med. 2011 Mar 18. 2. Analysis of proteomic profiles and functional properties of human peripheral blood myeloid dendritic cells, monocyte-derived dendritic cells and the dendritic cell-like KG-1 cells reveals distinct characteristics. Horlock C, Shakib F, Mahdavi J, Jones NS, Sewell HF, Ghaemmaghami AM.Genome Biol. 2007;8(3):R30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
49,497 Da
NCBI Official Full Name
Homo sapiens fibrinogen gamma chain, mRNA
NCBI Official Synonym Full Names
fibrinogen gamma chain
NCBI Official Symbol
FGG
NCBI Protein Information
fibrinogen gamma chain; fibrinogen, gamma polypeptide
Protein Family

NCBI Description

The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]

Research Articles on FGG

Similar Products

Product Notes

The FGG (Catalog #AAA6147202) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGG (Fibrinogen gamma chain, PRO2061, FGG) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FGG can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGG for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGG, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.