SDS-PAGE
Vesicle-fusing ATPase Recombinant Protein | Slip_1045 recombinant protein
Recombinant Rat Vesicle-fusing ATPase protein
Applications
SDS-Page, ELISA
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Vesicle-fusing ATPase; Recombinant Rat Vesicle-fusing ATPase protein; N-ethylmaleimide-sensitive fusion protein; Slip_1045 recombinant protein
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence
QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
Applicable Applications for Slip_1045 recombinant protein
SDS-PAGE, ELISA (EIA)
Preparation and Storage
Store at -20 degree C. For extended storage,conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Slip_1045 recombinant protein
Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
29 kd
NCBI Official Full Name
Vesicle-fusing ATPase
NCBI Official Symbol
Slip_1045
NCBI Protein Information
Vesicle-fusing ATPase
Protein Family
Similar Products
Product Notes
The Slip_1045 (Catalog #AAA719382) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Vesicle-fusing ATPase can be used in a range of immunoassay formats including, but not limited to, SDS-PAGE, ELISA (EIA). Researchers should empirically determine the suitability of the Slip_1045 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QAARCPTDEL SLSNCAVVNE KDYQSGQHVM VRTSPNHKYI FTLRTHPSVV PGCIAFSLPQ RKWAGLSIGQ DIEVALYSFD KAKQCIGTMT IEIDFLQKKN IDSNPYDTDK MAAEFIQQFN HQAFSVGQQL VFSFNDKLFG LLVKDIEAMD PSILKGEPAS GKRQKIEVGL VVGNSQVAFE KAENSSLNLI GKAKTKENRQ SII. It is sometimes possible for the material contained within the vial of "Vesicle-fusing ATPase, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
