Vesicle-fusing ATPase Recombinant Protein | NsfErg1 recombinant protein

Recombinant Rat Vesicle-fusing ATPase

Cat. Num. AAA1265211

• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Vesicle-fusing ATPase; Recombinant Rat Vesicle-fusing ATPase; N-ethylmaleimide-sensitive fusion protein; NEM-sensitive fusion protein; Vesicular-fusion protein NSF; NsfErg1 recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 7-209aa; Partial
• Sequence: QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
• Sequence Length: 744

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for NsfErg1 recombinant protein

Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Ses to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 membrane cycling.

References

Guan Z., Lu L.R., Zheng Z.C., Liu X.Y. Viswanathan V., Vincent S.R. Lubec G., Afjehi-Sadat L., Diao W.Submitted (APR-2007) to UniProtKB Pctaire1 phosphorylates N-ethylmaleimide-sensitive fusion protein implications in the regulation of its hexamerization and exocytosis.Liu Y., Cheng K., Gong K., Fu A.K., Ip N.Y.J. Biol. Chem. 281:9852-9858(2006) Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.Evers D.M., Matta J.A., Hoe H.S., Zarkowsky D., Lee S.H., Isaac J.T., Pak D.T.Nat. Neurosci. 13:1199-1207(2010)

NCBI and Uniprot Product Information

• NCBI GI #: 13489067
• NCBI GeneID: 60355
• NCBI Accession #: NP_068516.1
• NCBI GenBank Nucleotide #: NM_021748.1
• UniProt Accession #: Q9QUL6
• Molecular Weight: 26.5 kDa
• NCBI Official Full Name: vesicle-fusing ATPase
• NCBI Official Synonym Full Names: N-ethylmaleimide-sensitive factor
• NCBI Official Symbol: Nsf
• NCBI Protein Information: vesicle-fusing ATPase
• UniProt Protein Name: Vesicle-fusing ATPase
• Protein Family: Vesicle-fusing ATPase
• UniProt Gene Name: Nsf
• UniProt Synonym Gene Names: Erg1; NEM-sensitive fusion protein
• UniProt Entry Name: NSF_RAT

NCBI Description

binds AMPA receptor GluR2 subunit and acts to disrupt GluR2-PICK1 interactions; may play a role in AMPA receptor trafficking and stabilization [RGD, Feb 2006]

Uniprot Description

NSF: required for intracellular membrane fusion and vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Seem to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Functions as a SNAP receptor (SNARE) chaperone which binds, through soluble NSF attachment proteins (SNAPs), to SNARE complexes and utilizes the energy of ATP hydrolysis to disassemble them thus facilitating SNARE recycling. While this is a major function of NSF, it does seem to interact with other proteins, such as the AMPA receptor subunit, GluR2, and beta2-AR and is thought to affect their trafficking patterns.

Protein type: Vesicle; EC 3.6.4.6; Protease; Autophagy; Adaptor/scaffold

Cellular Component: cytoplasm; dendritic shaft; Golgi stack; lysosomal membrane; myelin sheath; plasma membrane; postsynaptic density

Molecular Function: ATP binding; ATP-dependent protein binding; ATPase activity; ATPase activity, coupled; D1 dopamine receptor binding; metal ion binding; PDZ domain binding; protein binding; protein C-terminus binding; protein complex binding; protein kinase binding; Rab GTPase binding; syntaxin binding; syntaxin-1 binding

Biological Process: Golgi to plasma membrane protein transport; Golgi vesicle docking; intra-Golgi vesicle-mediated transport; intracellular protein transport; neurotransmitter secretion; positive regulation of protein catabolic process; positive regulation of receptor recycling; potassium ion transport; protein transport; regulation of exocytosis; vesicle fusion; vesicle-mediated transport